1WPK


Conserved Protein Domain Family
Ada_Zn_binding

?
pfam02805: Ada_Zn_binding 
Click on image for an interactive view with Cn3D
Metal binding domain of Ada
The Escherichia coli Ada protein repairs O6-methylguanine residues and methyl phosphotriesters in DNA by direct transfer of the methyl group to a cysteine residue. This domain contains four conserved cysteines that form a zinc binding site. One of these cysteines is a methyl group acceptor. The methylated domain can then specifically bind to the ada box on a DNA duplex.
Statistics
?
PSSM-Id: 397095
Aligned: 283 rows
Threshold Bit Score: 57.4429
Threshold Setting Gi: 506377822
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1WPK_A               11 QRWQSVLARD--PNADGEFVFAVRTTGIFXRPSCRARHALRENVSFYANASEALAAGFRPCKRC 72  Escherichia coli
Q2KUD0               12 PRWAAVLARD--PQADAQFVYAVKTTGVYNRPSSAARLPRPENVVFFASAQEAEAAGYRPSKAA 73  Bordetella avium 197N
Q4KB69               14 PRWQAVLKRD--ASADASFVYAVRTTGVYCRPSSLSRLPKAENVEFFDSAEQAEAAGYRPSKRL 75  Pseudomonas protegens Pf-5
Q87Z36               19 PRWDILLNRRsgSAVSADFVYAVRTTGVYCTPGSPSRLPRPENVVFFDSASQAEAAGFRPSMRS 82  Pseudomonas syringae pv....
BoseInst:TKWG_18120  15 ARWQAVQNRD--RQADGHFVYAVKTTGVYCRPSSSARLPQRKNVVFFDTAQQAEAAGYRASRRA 76  Advenella kashmirensis W...
WP_015817224         11 ARWQAIQMRD--SHADGHFVYGVRTSGIYCAPSATARQPKRENVEFFDTAAAAEAAGYVASRRE 72  Teredinibacter turnerae
WP_013743429         16 ARWQAVQARD--HNADAHFVYAVRTTGVYCRPSSSARLPKRENVEFFSSAEAAEQAGYRANRRI 77  Pusillimonas sp. T7-7
Q1LGU1               12 DRWTAVQARD--AGADGHFVYAVRTTGVYCQPSSSARLPKRENVEFFDSAEIAEAAGYRCSRRA 73  Cupriavidus metalliduran...
WP_024912486         12 ARWQAIIERN--KAADGHFVYAVSTTGVYCLPSSAARLPKRENVTFFDTAEDAERQGYRPSKRL 73  Chania multitudinisentens
WP_013184529          8 ERWQAIIERN--KDADNHFVYAVRTTGIYCLPSSTARLPKRANVIFFDTEKEAEQHGYRPNKRL 69  Xenorhabdus nematophila
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap