5G1Z,1IYK


Conserved Protein Domain Family
NMT_C

?
pfam02799: NMT_C 
Click on image for an interactive view with Cn3D
Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
The N and C-terminal domains of NMT are structurally similar, each adopting an acyl-CoA N-acyltransferase-like fold.
Statistics
?
PSSM-Id: 397091
Aligned: 152 rows
Threshold Bit Score: 216.54
Threshold Setting Gi: 169802638
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5G1Z_C       198 EIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVN 277 malaria parasit...
XP_015791382 270 EVKFSHLTRNMTMARTIKLYKLPADPKLPGLRKLQKKDIPKVKKILNDYLRQFALAPQFSIEECTHWFMPRDEVVDSYVV 349 two-spotted spi...
EFO22806     281 EVKFSHLSRKMTMQRTLKLYKLPEQPKTANLTSLKECHIDGAYGLLQCYLKKFDLSPQFTRADFEHFFMPREDVIYSYVA 360 eye worm
EFX87611     217 DVKFSHLARNMTMQRTLKLYRLPEETKTPGFRTLELKDIEQAYRLLNTYLNKFHLAPCFDEEDFRHWFFPRPGIVDCYVV 296 common water flea
OWR53700     282 DVKFSHLSRNMTMQRTLKLFKLPDTPKTSGFRKMEVKDSDKVVKLLNDYLQKFDLVPIFSEEEFKHWFTPQAGIIDSYVV 361 Danaus plexippu...
EEB19465     167 EVKFSHLSRNMTMQRTLKLYRLPDTTKTPGFRKMVPDDILEVHKLLNKYLERFDLVPVFTVEEVRHWFTPQSGIVDAFVV 246 human body louse
EKC38289     347 AVKFSHLTRNMTMQRTLKLFKLPDNTKTPGFRPFTPADVTESYNLLKTYLDRFDLSPTFTIEEFRHWFIPRQGIVDTYVV 426 Pacific oyster
XP_016658909 275 DVKFSHLSRNMTMQRTLKLHKLPDSIRTPGFRKLTEKDLPQARKLLSNYMKTFDLSPMFSDEEFKHWFLPQEGIIDAYVV 354 pea aphid
EFA05466     281 EVKFSHLSRNMTMQRTLKLYKLPDSPRTPGFRKLTEAD----------YLRKFDLSPLFTEEDFVHWFLPRPDIVDSFVV 350 red flour beetle
KAE9437682    67 EVKFSHLSRNMTMQRTLKLFKLPDQPKTPGFRKMTVEDLPKARKLLSEYLTKFHLAPVFSEEEFRHWFFPQSGIVDAFVV 146 Apolygus lucorum
5G1Z_C       278 EENG--KIKDMISFYSLPSQILGNDKYSTLNAAYSFYNV-TTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDL 354 malaria parasit...
XP_015791382 350 EKDN--QIVGFTSFYTLPSTVMHHPTYKSIKAAYSFYNVpSPDVDLRDLMQDALIIAKNADHDVFNALDLMENQKFLENL 427 two-spotted spi...
EFO22806     361 LNEEgtKVTDLISFYSLPSSVMHHPQYKSIRAAYSFYNV-ATSVTLKQLINDALILARNCGFDVFNALDLMDNKEILEDL 439 eye worm
EFX87611     297 E--NggIITDLVSYYTLPSTVMHHPVHKSLKAAYSFYNA-SSTTPWNQLMSDALVTAKNAGFDVFNALDLMENKTFLEPL 373 common water flea
OWR53700     362 EG-SdgSITDFVSYYTLPSTVVYHPVHKTIKAAYSFYNV-STKTPWVELMLDALITAKNSGFDVFNALDLMENKEFLEPL 439 Danaus plexippu...
EEB19465     247 Q--EngKITDFVSFYTLPSTIMHHPVHKSLKAVYSFYNV-SNKTPWTDLINDALISAKNMGLDVFNALNIMDNKEFLEPL 323 human body louse
EKC38289     427 E--RngTITDFVSFYTLPSTIMHHPQHKLLKAAYSFYNV-STVTPWVDLMQDALIVAKNMGFDVFNALDLMENKEFLEKL 503 Pacific oyster
XP_016658909 355 E--NnnKITDLVSFYTLPSTIMHHPTYRTLKAAYSFYNV-STKTPWIELMQDALISARDANFDVFNALDLMDNKEFLEPL 431 pea aphid
EFA05466     351 E--KggKVTDFVSYYTLPSTVMHHPVHTSLKAAYSFYNV-SGETPWVDLMNDALISAKQSNFDVFNALDLMDNREFLETL 427 red flour beetle
KAE9437682   147 E--RdgEITDMVSYYTLPSTVMHHAVHRNLKAAYSFYNV-STKTGWMDLMTDALISAKNSGFDVFNALDLMENKEFLEPL 223 Apolygus lucorum
5G1Z_C       355 KFGEGDGSLKYYLYNWKCASFAPAHVG-------IV 383 malaria parasite P. vivax
XP_015791382 428 KFGKGDGSLQYYLYNWKCPSITPEKIG-------LV 456 two-spotted spider mite
EFO22806     440 KFGIGDGNLQYYLYNWKCPDIVPEKIG-------LV 468 eye worm
EFX87611     374 KFGIGDGNLHYYLYNWRCPDMPSNSVG-------LV 402 common water flea
OWR53700     440 KFGIGDGNLQYYLYNWRCPSITSNKIG-------LV 468 Danaus plexippus plexippus
EEB19465     324 KFGIGDGNLQYYLYNWRCPAILPEKIG-------LV 352 human body louse
EKC38289     504 KFGIGDGNLQYYLYNWRCPQMNPHQVGegygmikLP 539 Pacific oyster
XP_016658909 432 KFGVGDGNLQYYLYNWKCPEIHSSKIG-------LI 460 pea aphid
EFA05466     428 KFGIGDGNLQYYLYNWKCPSMAPHRMG-------LV 456 red flour beetle
KAE9437682   224 KFGIGDGNLQYYLFNWRCPPMQPNKIG-------LV 252 Apolygus lucorum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap