3SO4,6C07


Conserved Protein Domain Family
S-AdoMet_synt_C

?
pfam02773: S-AdoMet_synt_C 
Click on image for an interactive view with Cn3D
S-adenosylmethionine synthetase, C-terminal domain
The three domains of S-adenosylmethionine synthetase have the same alpha+beta fold.
Statistics
?
PSSM-Id: 397066
Aligned: 317 rows
Threshold Bit Score: 192.98
Threshold Setting Gi: 401773824
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3SO4_A             257 IGGPMGDAGLTGRKIIVDTYGGWGAHGGGAFSGKDSSKVDRSGAYCARWIAKSLVHAGLCHRVLVQLSYAIGVSHPLSIN 336 Entamoeba...
Q8DK88             252 IGGPQGDSGLTGRKLVVDTYGGYARHGGGAFSGKDPTKVDRSAAYMARYIAKNIVAAGLADKCELQISYAIGVARPMSLF 331 Thermosyn...
Q7VDM7             251 VGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARFVAKSLVAAGLASRVEVQLSYAIGVANPVSIL 330 Prochloro...
Q46H57             251 IGGPQGDAGLTGRKIIVDTYGGYARHGGGAFSGKDPTKVDRSAAYAARFVAKALVAANLAKKVEVQLSYAIGVAKPISIL 330 Prochloro...
jgi:Cyan10605_3394 254 IGGPQGDSGLTGRKIIIDTYGGYSRHGGGAFSGKDPTKVDRSASYAARYVAKNIVAAGLASKCEVQLSYAIGVAQPVSIL 333 Cyanobact...
Q31KC6             254 IGGPQGDAGLTGRKIIVDTYGGYSRHGGGAFSGKDPTKVDRSAAYACRYVAKNIVAAGLAEKCEVQLSYAIGVARPVSVL 333 Synechoco...
WP_006617824       255 VGGPQGDSGLTGRKIIIDTYGGYSRHGGGAFSGKDPTKVDRSAAYACRYIAKNIVAAGFADKCEVQVSYAIGVARPVSLF 334 Arthrospi...
WP_013386993       230 IGGPHGDAGLTGRKIIVDTYGGYFRHGGGAFSGKDPSKVDRSAAYAARWVAKNIVAAELAEKCEIQLSYAIGVVEPTSVK 309 Ilyobacte...
Q60BL6             241 rsGPAAHSGMTGRKSASDTYGGYARHAGSALSGKGPLRIDRVAAYAARHAAKNVVAAGLAEECEVQLSYTIGQARPVSVQ 320 Methyloco...
MGCB2:Clst_2237    233 IGGPAADSGLTGRKTIVDTYGGFSRFGGGALSGKDASKVDRSGAYMARYLAKNIVAAGLADKCEVQLSYAIGLTEPISVM 312 Thermoclo...
3SO4_A             337 VNTYGTGICDESILVDIVNKNFDMRPGMIIKELGLTR-------P--IFQKTAVGGHFGRndpDF--KWE 395 Entamoeba histolytica
Q8DK88             332 VDTFGTGKLSPEQLLELIKTHFDLRPAAIIQTLNLRHlpqerggR--FYQDVAAYGHFGRhdlDL--PWE 397 Thermosynechococcus...
Q7VDM7             331 VEAFGSGKMSNEALTELVTENFDLRPGAIIEQFGLRSlpnqrqgR--FYRDVAAYGHFGRpdlNL--PWE 396 Prochlorococcus mar...
Q46H57             331 VDSFGTGKVSDSELTQLVQDQFDLRPGAIIKAFDLQNlpsirggR--FYRDTAAYGHFGRtdiLL--PWE 396 Prochlorococcus mar...
jgi:Cyan10605_3394 334 IETFGTSTVSEDKLLPLVKANFDLRPAGIIQMFDLRNlpaqrngR--FYQDVAAYGHFGRidlDL--PWE 399 Cyanobacterium apon...
Q31KC6             334 VETFGTGKVADEVLLDLVRKHFELRPAGIIEHFNLQRlpgerggR--FYQEVAAYGHFGRndlDL--PWE 399 Synechococcus elong...
WP_006617824       335 IETFGTGKVDEQQLLKVVQENFELRPAGMIQEFNLRDlpglrggR--FFQDVAAYGHMGRtdlDL--PWE 400 Arthrospira platensis
WP_013386993       310 VDTFGTGKIEEVKLAEIVQKVFDLSPRGIELALELRS-------GnfKYQDLAAFGHIGRt--DIdlPWE 370 Ilyobacter polytropus
Q60BL6             321 VSTFGTGLVGEDVIKQRLEKHFDFRLGAIVRDFNLRRlpaeyrgS--FYRRLPAYGHFGAs--FTalPWE 386 Methylococcus capsu...
MGCB2:Clst_2237    313 VDTFGTGKVSDEELCNYIIHNIDLRPAVIIRKFGLNN-------P--IFSKVSCYGHFGSn--AInmPWE 371 Thermoclostridium s...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap