6BK5


Conserved Protein Domain Family
Cbl_N3

?
pfam02762: Cbl_N3 
Click on image for an interactive view with Cn3D
CBL proto-oncogene N-terminus, SH2-like domain
Cbl is an adaptor protein that binds EGF receptors (or other tyrosine kinases) and SH3 domains, functioning as a negative regulator of many signaling pathways. The N-terminal domain is evolutionarily conserved, and is known to bind to phosphorylated tyrosine residues. The so called N-terminal domain is actually 3 structural domains, of which this is the C-terminal SH2 domain.
Statistics
?
PSSM-Id: 397058
Aligned: 13 rows
Threshold Bit Score: 159.857
Threshold Setting Gi: 675882530
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6BK5_A       246 HPAYKAFITYDEVEAILRHHLHR--PGSYVYRLSCTRLGQWAIGFVTRAGKIVQTIPQNKSLYQALLDGVEERLYLYPDG 323 Salpingoeca ros...
PDM60022     257 HKGFVAFLTYDEVRKRLDRFINK--PGSYVFRMSCTRLGQWAIGYVAPDGKIYQTIPQNKSLIQALHEGGREGFYLWPDG 334 Pristionchus pa...
Q6ABG8       257 HPGYCAFLTYDEVKKRLEKLTKK--PGSYIFRLSCTRPGQWAIGYVAPDGKIYQTIPQNKSLIQALHEGHKEGFYIYPNG 334 Caenorhabditis ...
XP_001745549 229 HPAYQAFITYDEVEATLSNHRHK--PGSYVFRLSCTRLGQWAIGFVAKDGQIVQTIPQSKSLYQALIDGAEQGTFLYPNG 306 Monosiga brevic...
CDS37021     263 HAGYMAFMTYDEVKAVLKKFRSHpgPGSYVYRLSCTKLGQWAIGYITDNLRILQTIIQNKSLAQALLDGERDGFYLYPNG 342 Echinococcus mu...
XP_002112227 261 HPGYAAFLTYDDAKNALEPFLDR--PGSYIFRLSCTRLGQWAIAYVEESRNVVQTIPNNKPLRQALIDGFNDGIYLYPAG 338 Trichoplax adha...
XP_004364071 284 HPAYQAYMTYDEVNTVLKPFVNK--PGSYVFRLSCTRLGQWAIGYVNAEKKVVQTIPNTKSLYQALIDGSVDGTFKYPMG 361 Capsaspora owcz...
NP_001121724 247 HPGYMAFLTYDQVKARLEHYRHR--PGSYIFRLSCTQMGQWAIGHVTSDGSIVQTIPQNTPLYQALIQGFREGCYLYPDG 324 zebrafish
XP_012400422 160 HPGYMAFLTYDEVKARLQKFIHK--PGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDG 237 Tasmanian devil
EKC24300     250 HPGYVAFLTYDEVKARLQKYVTK--PGSYVFRLSCTRLGQWAIGYVTVEGQILQTIPQNKSLCQALLDGQREGFFKYPDG 327 Pacific oyster
XP_009026767 105 HPGYVAFMTYDEVKAMLAKFKDK--PG------SCTRLGQWAIGYVTKNNEILQTIPQNKSLGQALIDGQKEKYYLYPAG 176 Helobdella robusta
CCD82614     216 HPGYMAFMTYDQVKGVLKRYCTHpgPGTYIFRLSCTKLGQWAIGYITQELKIVQTIIQNKSLAQALVDGEREGFYLYPNG 295 Schistosoma man...
XP_030834172 239 HRGYMSFMTYDEVKNRLEQYISK--PGSYIFRLSCTRLGQWAIGYVTQDKTILQTIPQNKSLCQALIDGNREGFYLYPDG 316 purple sea urchin
6BK5_A       324 KN 325 Salpingoeca rosetta
PDM60022     335 ND 336 Pristionchus pacificus
Q6ABG8       335 RD 336 Caenorhabditis elegans
XP_001745549 307 ED 308 Monosiga brevicollis MX1
CDS37021     343 TP 344 Echinococcus multilocularis
XP_002112227 339 ND 340 Trichoplax adhaerens
XP_004364071 362 QD 363 Capsaspora owczarzaki ATCC 30864
NP_001121724 325 RD 326 zebrafish
XP_012400422 238 RN 239 Tasmanian devil
EKC24300     328 RS 329 Pacific oyster
XP_009026767 177 QA 178 Helobdella robusta
CCD82614     296 KP 297 Schistosoma mansoni
XP_030834172 317 CE 318 purple sea urchin
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap