1FTR


Conserved Protein Domain Family
FTR_C

?
pfam02741: FTR_C 
Click on image for an interactive view with Cn3D
FTR, proximal lobe
The FTR (Formylmethanofuran--tetrahydromethanopterin formyltransferase) enzyme EC:2.3.1.101 is involved in archaebacteria in the formation of methane from carbon dioxide. C-terminal proximal lobe of alpha+beta ferredoxin-like fold. SCOP reports fold duplication with N-terminal distal lobe.
Statistics
?
PSSM-Id: 397041
Aligned: 64 rows
Threshold Bit Score: 190.018
Threshold Setting Gi: 170777255
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1FTR_C         150 GEFIVEDSFGITTGVAGGNFYIMAESQPAGLQAAEAAVDAIKGVEGAYAPFPGGIVASASKVGSkQYDF-LPASTNDAYC 228 Methanopyrus ...
jgi:Mboo_0993  150 GWYTGEERFGLMKGIAGGNFLVMAEDRAAALSGAEAAMAKVAGTPGIIASFPGGIVGSGSKVGCkNYRFpMPASTNHRWC 229 Methanoregula...
WP_015285950   144 GDYIGEERYGTVKGIAGGNFLVMGKDQPSALAAATAAAASIRGMPGIIMSFAGGIVKSGSKVASkNYRFpMPASTNHLFC 223 Methanoregula...
WP_013414168   148 PDFKIERKIGYQKGIMGANFWYMCETKEAVLEAGEKIIKAINKIDYVITPF--DVCSAASKPET-NYPW-IGPTTNHPYC 223 Methanothermu...
Q2NI77         145 PDFYIEQKLGCMQGIMGVNFWYYCSTKEAVLEAGYKALDALSEVDGICTPF--DICSAGSKVET-NYPE-IGPTTNHPYC 220 Methanosphaer...
agres:mru_1393 146 PDFQIESELAYAEGIMGGNFWYMCSTKEAVLKAGRIIIDTIMEVDGVCTPF--GICSAASKPET-NFPE-IGPSTNHPYC 221 Methanobrevib...
WP_016358526   147 PDFLIDKEMGYGNGIMGANFWYMCSTKEAVLEAGRNIVDAILNVPGACAPF--GVCSAASKPET-NFPQ-IGPSTNHPYC 222 Methanobrevib...
O26503         148 PDFKIESRMGYREAIMGANFWYMCRDPDTVLEAGRAAIRAIEEVEGVVTPF--DICSAASKPET-NYPW-IGPTTNHPYC 223 Methanothermo...
WP_023992263   155 PDFLIESRLGYMEGIMGANFWYFSRSKEAVLEGGRAALKAIEKVEGVITPF--DICSAASKPET-NYPW-IGPTTNHPYC 230 Methanobacter...
Q8TX60         151 GEFLIERRLGYAEGVAGGLVWLFCEDVDAALEAGYRAVEALRDVEGVITPF--NVCAAGSKPET-IYPD-IGPTTNHPYC 226 Methanopyrus ...
1FTR_C         229 PTVED-----NELPEGVKCVYEIVINGLNEEAVKEAMRVGIEAACQQPGVVKISAGNFGGKLGQYEIHLHDL 295 Methanopyrus kandleri
jgi:Mboo_0993  230 PALKNki-pdSLVPDGVGAVYEIVINGFDEAAIAGAMREGIRAAAATGKVSCIGASNFEGKLGQTRINLHAL 300 Methanoregula boonei 6A8
WP_015285950   224 PTLKGki-sdSLVPDGVGSIYEIVMNGTDETAIRDAMRRGITAATQTGMASHIGASNFDGKLGQHRFFLHPl 294 Methanoregula formicica
WP_013414168   224 PSLKSrlgkdSKVPEGVKYIPEIVINGLKEDKIKEAMKVGIEAATTVDGVLRISAGNYGGKLGEYKLRLYDV 295 Methanothermus fervidus
Q2NI77         221 PSLKEklgdeSMVEDGVNYIPEIVIDALTVENAKESLKKGIEALNGVEGVIKVSAGNYGGNLGKYKFNLKDV 292 Methanosphaera stadtm...
agres:mru_1393 222 PSLRErlgkeSKVPEGVNYIPEIVINAVSQEAMNLAIKKAVDAIIDIGGVERISAGNFEGQLGEHKTNLLDI 293 Methanobrevibacter ru...
WP_016358526   223 PSLKErlgdeSKVPDGVNYIPEIVIDAVNEESMRKAVKAAIDSILDIDGIVKISAGNFGGKLGEDTFYLHDI 294 Methanobrevibacter sp...
O26503         224 PSLKEvlgdeSRVPEGVGYIPEIVINGLTMEALEEAMRAGIEAVCRYDGVLRVSAGNYDGKLGDHRIDLHGv 295 Methanothermobacter t...
WP_023992263   231 PSLQKilgskSQVTPGVNYIPEIVLNGLTLEGLKKAMKAGIDVLLDYEDVIGISAGNYGGKLGDHQINLLDL 302 Methanobacterium sp. MB1
Q8TX60         227 PTLRDri-ldSKVPEGVEAIPEIVINGVSLDVVKRAIGIAIEAATEVDGVVKVSAGNFGGKLGDYRIPLREc 297 Methanopyrus kandleri...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap