4ZOH,1N60,5G5H


Conserved Protein Domain Family
Ald_Xan_dh_C2

?
pfam02738: Ald_Xan_dh_C2 
Click on image for an interactive view with Cn3D
Molybdopterin-binding domain of aldehyde dehydrogenase
Statistics
?
PSSM-Id: 397038
Aligned: 477 rows
Threshold Bit Score: 374.517
Threshold Setting Gi: 13815376
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4ZOH_A                 121 VHSGLSSNIYYh--eRWKGGDVEKAFKEADltISDTLINQRVIASPLETRGALAYFD-GNKLTFYSSTQSAHYLRRNLVD 197 Sulfu...
WP_013558727           152 VHP-QPGTNIAhryrLWR-GNVEQAFREAHlvVENEYWIPWIAHVQMEPHGAIAQYD-GERLTIYTSSQSPFYVRETVAY 228 Anaer...
WP_014297139           159 IYNIEPERNVFhh-hKTRKGDVEKGFKEADviVEGDYYLPQMYHAPLEPHAAIAFWdyNEKLTVWSSAQSPFTLRNLIAH 237 Marin...
jgi:Noca_4271          156 FSP-QPGTNVAhv-qKVRKGDLDRGFAEAEwvVEREYTNPSVQHVPLETHVAVVQWkaGDQVTIWTSAQSPFTVRNLFCT 233 Nocar...
goetting:Cspa_c09690   155 VYP-EENTNIShr-iKIRKGDLRKGWEESEvaVCEKFSLPQSDHAAMETRSAKAEImpDGRVIIYTSSQAPYSVKKLLSK 232 Clost...
Q891A4                 161 VYP-QPNSNIAnh-vKIRKGDMNKGWSESEviVESSFSLPQSDHLAMETRNAKVEIlpNGTVIINTSSQGPFSVKEQISK 238 Clost...
Q5L316                 149 THP-EPGTNVAhr-tKIRKGNIEQGFAESDviVETSVSFAPSDHIAMETRCATAEIwpDGTIHISASSQSPFMIKKLLHT 226 Geoba...
WP_015594288           153 IYP-EPGTNIAhr-tKIRKGDIHIGWNDSEvtIEEKFSIRPSDHVAMETRCSFAEIhsNGDVEITSSSQAPFMIKRLIAD 230 Bacil...
PRJNA61369:DESME_11635 152 AYP-EPGTNIAnr-tKIRKGDLKKGWAKSQiiIESNISFPQSDHVAMETRCSIAQIkpDGEIIIYTSTQTPFSVKKLISL 229 Desul...
CAL81810               154 VFP-EPNTNIAnr-tKIRKGDIKKGWHESEvtVEASFSFPPSDHAAMETRSVTARIlpDGRVIIYSCSQAPFAIKKLISH 231 Clost...
4ZOH_A                 198 FLGF--ENIRVIQPDVGGAFGSKIIAHPEEYALAKLALML-RKPLKWVPTRTEEFISAGHGRDKKLKFEVAVKKDGTILG 274 Sulfu...
WP_013558727           229 LLDMssANVRVQVPYVGGGFGGK-SDVTIEPLLALVAYHVpGLPIRLILTREEMFFGTVNGRGCWGRMKTAVDRDGKLLA 307 Anaer...
WP_014297139           238 AFKIprHKVRVIAPYVGGGFGGKAGINMEGIVIALAEKVK-GRHIKLVYTREEDVA-TVVRQAMYAHIKTGVENDGTIVA 315 Marin...
jgi:Noca_4271          234 AMRLplNQVRVVVPHVGGGFGGK-AGIHLEPLVACLSRKAgGRPVRLQATREEEFSLLPCRSALTYRIRTGVRSDGTITA 312 Nocar...
goetting:Cspa_c09690   233 YYNIpeGNIIVKVPFVGGGFGGK-APMQLEIIAYLAAKAVnGKTVKIANSREEDIKTSPCKIGVEANLKLGATKDGIITV 311 Clost...
Q891A4                 239 LYNIpeGNIIVRVPLVGGAFGGK-ATIQPEFIAYLASRAVgGRKVKMANSREEDISMAPCKIGTEGSLKIGATKDGLIKA 317 Clost...
Q5L316                 227 YFGEetGKVIVHTPLVGGAYGGK-APVQLELLAYLASKAVgGRKVSVWNSREHDMVTSPVHIGLEATVKIGATKEGLLKA 305 Geoba...
WP_015594288           231 YFNLktGKVIVHTPLVGGGYGGK-APVQLEILAYLASKAVnGRLVKLANIREDDMLTSPCHVGLDATIKLGCSRDGMLKV 309 Bacil...
PRJNA61369:DESME_11635 230 YFNIepQKVTVKTPLVGGAFGGK-TSVQLEILAYIASKSVgGKAVKMLNSREEDMITSPVHIGLDAKVKLGCTTEGKIAA 308 Desul...
CAL81810               232 FFNIdpGKVIVHVPLVGGAYGGK-TAVQLEFIAYLCSKAVgGRQVKLTNTREEDFITSPVHIGLDAKIKLGSTKAGRLTA 310 Clost...
4ZOH_A                 275 IRGTLIANLGAPypdANDDESGNVKSTVRMLpGIYKIIGADIDAYAVHTNITPTQSYRGAGRPEGIYFIERIVNIVADEL 354 Sulfu...
WP_013558727           308 HQSELYFGSGGY---ADYSIWISQGGGHNAT-GPYYIPNLDLRSHAVYTNTPPTGAYRGYGHPEVHWMMESQMDQIARQL 383 Anaer...
WP_014297139           316 MEAELIFDGGAY---AEYGTNVVRAAGYTLP-GPYYVPNLKTDSFGVYTNHFIGGAFRGFGHGELHWATERNLDEVAQKL 391 Marin...
jgi:Noca_4271          313 QQMTMYWDAGAY---ADYAVNVTRASGYSAG-GPYEIPNAAVDSYAIYTNKPYGTAYRGFGHVEFFWGLERHMELVAQAI 388 Nocar...
goetting:Cspa_c09690   312 LEANYMVDGGAY---ADIGPRMAKAVAVDCS-GPYNIDNIWCDSICVYTNHTYATSYRGFGHAEYTFCMERMMDRLAKKL 387 Clost...
Q891A4                 318 LECTYHVDCGAY---ADTGPNMTKAIAVNCS-GPYNIENISCDAFTIYTNHTYVTSYRGFGHSALTFCMERILDKLATTI 393 Clost...
Q5L316                 306 MEILFLFDGGAY---SDKAIDVSRAAAVDCT-GPYHVENVFCDSLCVYTNRPYATPFRSFGHCEQAFAVERAIDELARTL 381 Geoba...
WP_015594288           310 AEIVYLFDSGAY---SDKAIDLSRAGAVDCI-GPYRVDHIWCDSLCVYTNHPYPGPFRGFSHSEVLFCFERSMDILAKKL 385 Bacil...
PRJNA61369:DESME_11635 309 AEITHLFDGGAY---SDRGAIISKAAAVDCT-GPYNIDNLWCDSLCLYTNHPNAVAFRGFGHLELTFAIERAMDILADQL 384 Desul...
CAL81810               311 TEITYLFDGGSY---SDKAVIISRAAGIDCT-GPYNIENVWCDSLCMYTNHPYAAAFRGFGHPELTFVIERSMDILADKL 386 Clost...
4ZOH_A                 355 GIDQYEIRLKNAID--TL-P-YTNifGvTYDSGNVKKLLEIGKKY--YDELKKEd------------GCVGVSSYIEITA 416 Sulfu...
WP_013558727           384 GMDAVELRLRNLLRpgLQnA-IGQt-MkEYN-GRADACLLAVRDAlgKET---Tptvp------griRAQGIACFMKSPV 451 Anaer...
WP_014297139           392 GIDPLELRLKNVLKpgLT-NsMGQt-I-HHDTGDVEACLKKAAELieYDKKPEQpadp------kkkRGKGIAGLVKAPa 462 Marin...
jgi:Noca_4271          389 GMDPLEFRRRNLLRpgSLtM-TGEr-ItEHT-GDPRACLDAVAEAidYGRL--TpeeaaherstgrrIGKGVATLHKAPA 463 Nocar...
goetting:Cspa_c09690   388 NMDPLELRIKNAIIpgQYtP-TQVk-TsESNIGSLLGCINKLKELakWDEG--Qitkte----egmiKAKGIGCFWKTSN 459 Clost...
Q891A4                 394 GIDPLELRMKNAIYegCFsP-TQDk-ItLSNTGNLGSCILKLKEAinWEEG--Rrvetd----kgtiIAKGTACFWKTST 465 Clost...
Q5L316                 382 QLDPWDVRRKNAIRpgHTtP-TQVr-LtKSNVGNISACLDRLRELmrWDEW--Qrvevd----aytvRAKGISSGWKTST 453 Geoba...
WP_015594288           386 RMDPLELRSKNAIKpgDTtP-TQFi-LnSSTVGNLPKCISRLKELfhWDEG--Qvfdlg----nnkvRAKGISCIWKTST 457 Bacil...
PRJNA61369:DESME_11635 385 NMDPIELRLKNAIIpgNTtP-TQTl-LnSSNIGNLPACLKRLRELihWDEG--Rriqig----nnkvRAKGVSCIWKNSN 456 Desul...
CAL81810               387 GMDPLELRLRNAILpgDTsA-TQIl-LnKSNLGNLPQCIQKLIELinWGEV--Deaete----dgkvRAKGVSCFWKNSN 458 Clost...
4ZOH_A                 417 FGPw--E-V-ARISVKYDGKITLVTGTGPHGQGDATAFAQIAADVLELpIEKIEVRWG-DTEIIEDGIGTWGSRTVTIGG 491 Sulfu...
WP_013558727           452 MKTnaqS-G-AVIKFNEDGTATLFTGSIEMGQGVNTILTQIAAETLHMpIEQVQYAPVvDTEYSPQEWQTVASHSTWAVG 529 Anaer...
WP_014297139           463 mp--tnAaSaVVIKFHEDATVTLQASIQEIGQGFNTAVTQMAADALHIsPDKIHFVMPvDTDVNPYEWQTVASRALWTVG 540 Marin...
jgi:Noca_4271          464 MPSftaT-A-AVVKMNSDASVVVNIALMEIGQGCNTALAQIVAERLRFpVERVKVAVErDTDKDPYDWQTVASKGLILSG 541 Nocar...
goetting:Cspa_c09690   460 SPTnavS-G-VLITFNTDGSINLNSGAVEIGQGTKTTLAQILAEKLKMdVGKIHLFMGvDTQVSPEHWKTVASMTTFMAG 537 Clost...
Q891A4                 466 SPTnasS-G-AIITVNSDGSLNLNLGAVEIGPGMKTTMVQILAEKMRMdIDKISIYMSvDTQTTPKHWKTVASMTTFMVG 543 Clost...
Q5L316                 454 IDTdasS-G-VILTFNSDGSVNVISGVVEIGTGTKTVLAQIVAERLKMdVDCVHVKMDiDTQTTPEHWKTVASRGTFMAG 531 Geoba...
WP_015594288           458 IDPnagS-G-AIITFNKDGSLNLMSGVVEIGTGTKTVLAQILAERLNMdVNKVHVQMEvDTRNTPEHWKTVASRGTFMAG 535 Bacil...
PRJNA61369:DESME_11635 457 TPInagA-G-AILTFNHDGSINIHTGAIEIGQGTKTVLAQILAERMKMdISKIHVDMEvDTKIDPDHWKTAASRTIYLVG 534 Desul...
CAL81810               459 TSLnagG-G-AVLTFNLDGSINLICAAVEIGQGIKTALAQILAEKMKMdVDQIHVTMEvNTKTNPEHWKTAASRTTLLVG 536 Clost...
4ZOH_A                 492 SAVLLASQKLKDKLIEIGAKILNADKEEVEYKEGNVTHKk-NGNKV----TFNEIVK-NAFK------MGE-------SL 552 Sulfu...
WP_013558727           530 NAVRMAAEDALEQLRHAAALVFDVPPDEVVAddGCLYPQ----GKPekalPYSRFAV--GYTrpdgsaLNP-------PV 596 Anaer...
WP_014297139           541 NALYRAAEDALNQIKNIASQVLGVAPHNLEVEDDRVYVKyrPEKYL----LLKDVVM--GYTypdghaIGG-------PV 607 Marin...
jgi:Noca_4271          542 NACLLACDDLLRQAYEVAGQVLRANVADLDHDADRVFVKhrPEESV----TFAELSV--GYAfpngngIGG-------PL 608 Nocar...
goetting:Cspa_c09690   538 RAVIRAAEDLIRQLKSLAATIMKSPPEDLEVENEKVYLKqnPEIYV----SFKDLVR-GH--------QEAnglavegQI 604 Clost...
Q891A4                 544 NAVVKAADDLIQQLKKLGAIVLKCTPEDLEIKEQKVYLKddLEIYI----SFEDLVH--GYKypggtsIGG-------QM 610 Clost...
Q5L316                 532 RAALAAADDAIRQLKDIAACVLRASPDDLEVGFGRVFLRddPAIFL----PIKDIAY--GYKfpngnaIGG-------QV 598 Geoba...
WP_015594288           536 RAVLEAAEDVIVQLKKISSTVLRVPIEDLEVADSKVFARddPKISL----DFVDIVYgytyp--ngnsIGG-------QI 602 Bacil...
PRJNA61369:DESME_11635 535 GAVLEAAEDAMHQLKTTASRVLNISTQDLDVseSRVFWR----QNPrvglGFESIGSqVI--------GRG-------RF 595 Desul...
CAL81810               537 RAVLRAAEDAINQLCDIAAVVLGRSPVELEVGRGRVFLK----DNPqigiEISKIAF--GYIlpngnsIGA-------QV 603 Clost...
4ZOH_A                 553 DTTAIYnv-----------kQPP--TTPYGVH--LALVKVDG-TGKVFVKKYVAVDDVGTVINPLLAEGQAIGGIVQGMA 616 Sulfu...
WP_013558727           597 IGRGMFvprgltfpdpatgqGNMaaSWTFGCQ--GVDLEIDPdTGQIHVLRMASAQDAGRIINPVTARGQVEGAMTMALG 674 Anaer...
WP_014297139           608 IGRGSFvpemltnldletgqGNAaaEWTFGAQ--AAEVEIDTeTGEIKVLSMVGVFDAGTIINPITAGGQVVGGMIQGMG 685 Marin...
jgi:Noca_4271          609 VGVGRYiaqgltnldketgqGLPalDWTYGAH--GVVVDVDPeTGEFDVLAISSAYDVGRVVNPGLVRGQAIGGMVQGLG 686 Nocar...
goetting:Cspa_c09690   605 LGRGSYimshitgldkesgkGKPgpAWTVGVQ--GVEIEYDPkTYTYRLIKAITVIDAGKLINPKTSRGLVMGGINMGFG 682 Clost...
Q891A4                 611 IGRGTYimkhltkleketgkGKVgaSWTVGAQ--AVEIEYDPkKYTYRLLKAATVIDVGKLINPKTARGLIMGGMSMGLG 688 Clost...
Q5L316                 599 IGRGHYilrhltpldpetgaGKP--GPEWGVCaeGVEIEFNRrDYTYRIVKAYAVIDAGKVLNPKAALGQAMGAMSMGLS 676 Geoba...
WP_015594288           603 IGRGNYiltqmvnldketgtGRPgpEWTVCAN--GVEIELDKrDYTYKILKAISVVDIGKVLNYKGAVGQVIGGMSMGLS 680 Bacil...
PRJNA61369:DESME_11635 596 VMKGLTgldp------etgrGNPgpDWAVGAQ--GVEVELDLkEYTYKILKAVSVIDAGKVLNPEAAKGQITGGMNLGLS 667 Desul...
CAL81810               604 IGRGSYafnnlttldpktgkGNPgpEWTVGAA--AVEIELDKkEYTYKIIKAACVIDAGKVINAGGARGQISGGMNLGLS 681 Clost...
4ZOH_A                 617 QALLEGAFFDENGQLLTTNFQDYPIPTAVEIP 648 Sulfurisphaera tokodaii str. 7
WP_013558727           675 AALMEKLKFAPDGRILNAGFVDYRILCAADVP 706 Anaerolinea thermophila
WP_014297139           686 PALFEGVKYNDKGYPLTVSFTDYKIPTIADIP 717 Marinitoga piezophila
jgi:Noca_4271          687 TALCEGYIYDQQGRLLNPSFTDNKIPTARDIP 718 Nocardioides sp. JS614
goetting:Cspa_c09690   683 LATREVFIYDSNAILQNTTFRTYKPMRFGEnp 714 Clostridium saccharoperbutylacetonicum N1-4(HMT)
Q891A4                 689 LATREEFLYNQDGILEDTSLRTYKLMRYGENP 720 Clostridium tetani
Q5L316                 677 FASREGFLFDNEQRVLNPQLRTYRPIRFGEHP 708 Geobacillus kaustophilus
WP_015594288           681 YAGRETFIFDREGRVLNPQLRTYRPIRFGEHP 712 Bacillus sp. 1NLA3E
PRJNA61369:DESME_11635 668 FSSREYFIFNDNGIIQNPQLRTYKILHFGENP 699 Desulfitobacterium metallireducens DSM 15288
CAL81810               682 FASREAFLFTNKGIVQNKQLRTYNIMRLGENP 713 Clostridium botulinum A str. ATCC 3502
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap