3MOG


Conserved Protein Domain Family
3HCDH_N

?
pfam02737: 3HCDH_N 
Click on image for an interactive view with Cn3D
3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
This family also includes lambda crystallin.
Statistics
?
PSSM-Id: 397037
Aligned: 57 rows
Threshold Bit Score: 156.93
Threshold Setting Gi: 81465232
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3MOG_A            7 TVAVIGS-GTMGAGIAEVAASH-GHQVLLYDI--SAEALTRAIDGIHA--RLNSRVTRGKLT------AETCERTLKRLI 74  Escherichia ...
Q9RUA4          309 SAGIIGA-GTMGGGIAMNFLNV-GIPVTIVET--SQEALDRGLGVIRK--NYENTAKKGRMT------QDDVEKRMGLLT 376 Deinococcus ...
Q88L88            9 QVAVIGA-GTMGRGIVISLANA-GLSVLWLDC--NAAALEAGLGMVSQ--AWAQQVDKQRIT------QAQADACLARVQ 76  Pseudomonas ...
O17761           41 SVAVIGG-GTMGRGIAIAFCLS-GFETYLVEV--NNKAAEFCKNELEI--TYKREKAFRRLN------DSKVEKLRKNLQ 108 Caenorhabdit...
P55100          301 SVGVLGL-GTMGRGIAISFARV-GIPVIAVES--DPKQLETAQKLITS--ILEKEASKSRQQcgqqrsGPKP-------R 367 domestic gui...
wugsc:CKO_00862   3 NVAVIGA-GVMGTGVAHNMAQY-GISTNVVDI--SQSQLDKCRQMIEAnlRLYNFHPQHKKK------THSTAEIMENIR 72  Citrobacter ...
Q6KYW3            2 RVTVIGA-GTMGSGIAEVFALN-NHEVLLSDV--SNDILNNGRKKIEA--SLEKFKEKGRIK--------SVEDVLEKIS 67  Picrophilus ...
Q8FRN7           14 QAVVIGA-GSMGAGIATLLANA-GITVTLLDR--HSGDPEDPNRLAES--GLERQIQRGAFY------RPEFSSRIQTGN 81  Corynebacter...
Q5SJW2            4 KVGVVGA-GTMGSGIAALVASA-GIPVVLLDIpgKEDRNEYAKRGLER--ALKA--RPAAFM------DPERARYIEIGN 71  Thermus ther...
Q8EYS5            6 TVTVLGAnGTMGAGSAAIVASFgKAKVHMLAR--DTNKAKEGIEKAI-----------GSVK------TDTIRPRLIPGS 66  Leptospira i...
3MOG_A           75 PVTDIHALA-AADLVIEAASERLEVKKALFAQLAEVCPPQTLLTTNTSSISITAIAAEIKNPER--VAGLHFFNPAPVMK 151 Escherichia ...
Q9RUA4          377 PTLKMEDLA-GADIIIEAVFENMDVKKDIFTRLDKIAKPGAILASNTSTLDVNEIASVTGRPEQ--VIGLHFFSPANVMK 453 Deinococcus ...
Q88L88           77 AVDGYPALA-EADLVIEAVYENLALKQEIFCALDAHLKPRAILASNTSALDIDAIAAVTQRPSQ--VLGLHFFSPAHVMK 153 Pseudomonas ...
O17761          109 ITTDFQKLN-NCDLIVEAVFEDMKLKKELFTKLDKICKPSCIFGTNTSSLDLNEMSSVLRDPTK--VVGIHFFNPANLIR 185 Caenorhabdit...
P55100          368 FSSSMKDLA-SVDLVVEAVFEDMNLKKRVFAELSAVCKPEAFLCTNTSALDVDEIATSTNRPQQ--VIGTHFFSPAHVMK 444 domestic gui...
wugsc:CKO_00862  73 FTTELDDIV-ECDLVIENITEDIEKKNALYTRMNTICGASTVFGVNTSAISITALSKLMRHPEN--VVGVHFMNPVPLMH 149 Citrobacter ...
Q6KYW3           68 MNTDINAQ--ESDLYIEAVLERIDVKRDVLSRI----RSDSIIATNTSSISITYLSKFVRNPEK--FIGMHFFNPPPIMS 139 Picrophilus ...
Q8FRN7           82 IVDDTAALT-RADWIIEAVFEDLTVKHDTFRLIEEHRSPGSLVSSNTSTIPLAQLTEVMGTPMRldFAIVHFFNPPTTMR 160 Corynebacter...
Q5SJW2           72 TEDHLEKLR-DCDWVVEAIVEKPEPKQALYARLENLLKPTAIVSSNTSGIPMRVLLEGRSEGFRrrFLGTHFFNPPRYLH 150 Thermus ther...
Q8EYS5           67 YDADLEKAVsESDWVFELVAESYEVKEPINKRIASSRRPGTIVSTVSSGLSIERLSKAFDEDGQkhYFGTHFFNPPYKMI 146 Leptospira i...
3MOG_A          152 LVEVVSGLATAAEVVEQLCELTLSW-GKQPVRCHST 186 Escherichia coli K-12
Q9RUA4          454 LLEIVRADKTSDSVLATSLALAKRI-KKVGVVVGVC 488 Deinococcus radiodurans
Q88L88          154 LLEIVRGTHTDQKVLDAAKALGERM-GKVAIVAGNC 188 Pseudomonas putida KT2440
O17761          186 MVEVIYGSKTSSKAVATAFEACRSI-KKLPVLVGNC 220 Caenorhabditis elegans
P55100          445 LLEVIPSRHSSPTTIATVMDLAKKI-KKVAVVVGNC 479 domestic guinea pig
wugsc:CKO_00862 150 TVELIRGVHTAERTLNIFHHLFAQL-NKTGIVVNDs 184 Citrobacter koseri ATCC BAA-895
Q6KYW3          140 LIEIVRGNSTSDETTKRIVDISRSL-GKTPVEVNDF 174 Picrophilus torridus
Q8FRN7          161 LVELVTGPDTTPKTATDLTRIIEQQlGKVVLHCRDT 196 Corynebacterium efficiens
Q5SJW2          151 LLELIPTPETDPKVLEEIRRFGERIlGKGTVLAKDs 186 Thermus thermophilus HB8
Q8EYS5          147 LCELVSHKGSDKKVLKQLGEYLEKVlGRAVVYTNDT 182 Leptospira interrogans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap