3PNM


Conserved Protein Domain Family
Dak1

?
pfam02733: Dak1 
Click on image for an interactive view with Cn3D
Dak1 domain
This is the kinase domain of the dihydroxyacetone kinase family EC:2.7.1.29.
Statistics
?
PSSM-Id: 397033
Aligned: 308 rows
Threshold Bit Score: 290.837
Threshold Setting Gi: 212515188
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3PNM_A            18 AGLAKAHPS-LTLHQD--PVYVTRA--DAPv--AGKVALLSGGGSGAEPMHCGYIGQGMLSGACPGEIFTSPTPDKIFEC 90  Escherichia...
WP_015247210      17 EGLVATYPG-LVRLPGq---AVVVRsdAREe-rDRHVTLISGGGSGHEPAHAGYVGRGMLSAAVLGEVFTSPSPDAVLAA 91  Singulispha...
Q1DEN7            17 eGLVSLAPG-QVLLDGe---SVVLRadTPSdvrARKVAVISGGGSGHEPAHAGYVGAGMLDAAVAGDVFTSPSTDAVLAA 92  Myxococcus ...
AAK89855          17 EGIVALSPE-TILLQDe---NVVIRsgLPEa-eKRKVAVLSGGGSGHEPAHAGYVGTGMLTVAVAGDVFTSPSTDAVLAG 91  Agrobacteri...
Q13R55            17 DGLAALNPH-LSLLQGs---TIIVRadAEAaaaRGEVALISGGGSGHEPAHGGYVGPGMLSAAVAGEVFTSPSTDAVLDA 92  Paraburkhol...
ACR27904          17 NGFVALHPH-LALLADr---TIVVRadAAEaasRGEVALVSGGGAGHEPAHAGYVGAGMLSAAVAGEVFTSPSVDAVLDA 92  Burkholderi...
6_pfamImport       1 EGIALSHPH-LVLERSq---CVLLHrnYREi-rECQVTLVSGGGTGHEPAHAGYIGTGMLTAVVCGGVFASPSTQQVLTA 75 
CBN77364          36 glvnvcNPGrLTKLPDh---DVVLRadISTi-kERQVTLISGGGSGHEPAFAGYVGDGMLTAAVCGGVFASPAASAVLEA 111 Ectocarpus ...
jgi:MICPUN_98137  18 EGFVQSHPG-VKLLDGfpDVKVVVRshVD----KNKVALVSGGGSGHEPAHAGFVGDGMLDAAVCGDVFASPSVAAVLAA 92  Micromonas ...
EEF28649          20 ieglsetypglQYLDGfpEVKVVLRadVSSs-sYDKVAVISGGGSGHEPAHAGFVGEGMLTAAICGEVFASPNVDAILAG 98  castor bean
3PNM_A            91 AMQVDGGEGVLLIIKNYTGDILNFETATELLHDsGVKVTTVVIDDDVAVkDSLYTAGRRGVANTVLIEKLVGAAAERGDS 170 Escherichia...
WP_015247210      92 IRAVAGPPGVLLIVKNYTGDRLNFGLAAEMARAeGFDVEMVVVADDVALaATADNAGRRGLAGTILVHKIAGAAAEAGAS 171 Singulispha...
Q1DEN7            93 IRAVAGPAGALLVVKNYTGDRLNFGLAAELARAeGIPVETVVVADDVSLhDTVEPARRRGIAGTVLVHKVAGAAAEAGAA 172 Myxococcus ...
AAK89855          92 IRAAAGPAGALVIVKNYTGDRLNFGLAAELARAeGIPVEIVVVADDVALkDTVPAERRRGIAGTVLVHKLAGAAAEKGLP 171 Agrobacteri...
Q13R55            93 IRAVAGAAGALLIVKNYTGDRFNFGLAAEIARAeGIPTEMVIVADDVALtASGDHAGRRGLAGTVLVHKIAGAAAASGRP 172 Paraburkhol...
ACR27904          93 IRAVGGPAGVLLIVKNYTGDRLNFGLAAEIARAeGIDVEMVIVADDVALaARGEHAGRRGLAGTVLVHRIAGAAAAAGLP 172 Burkholderi...
6_pfamImport      76 IRLAGGPHGCLVLVKNYTGDRLNFGLAVEQAKAeGIKCYMVVIGDDVAV--IQANAGRRGLSGTVFVHKLAGAAAKAGTD 153
CBN77364         112 IRAACGPLGCLVLVMNYTGDRLNFGMAVERAKAeGYNVRMHVVADDCALpRDKGITGRRGVAGTVLVAKVAGAAAEAGLS 191 Ectocarpus ...
jgi:MICPUN_98137  93 IRHVTGPPGCLLIVKNYTGDRLNFGLAAERAKLeGLNVEMVVVADDCALpPPLGVAGRRGLAGTLFVHKCAGAAAAAGDA 172 Micromonas ...
EEF28649          99 IRAVTGPMGCLLIVKNYTGDRLNFGLAAEQAKSeGYKVETVIVGDDCALpPPRGIAGRRGLAGTILVHKVAGAAAAAGLS 178 castor bean
3PNM_A           171 LDACAELGRKL--NNQGHSIGIALGACTVPAAGKPSFTLADNEMEFGVGIHGEPGIDRRPFSSLDQ---TVDEMFDTLL- 244 Escherichia...
WP_015247210     172 LEQVTAEARAA--AEAVGTMGVALTPCTVPAAGRPSFSLGDDEIELGLGIHGEPGVRREPLEPADD---LVDHLINAILg 246 Singulispha...
Q1DEN7           173 LQDVLREATAA--AEVLGTMGVALGPCTVPAAGKPGFTLEEDEIELGLGIHGEQGVRRVPMQTADS---LVDTLLTTIVe 247 Myxococcus ...
AAK89855         172 LQEVARIARDA--AAKLSSMGVSLGSCTLPAVGKPGFVLGETEIEVGLGIHGEQGVQRMPIASADA---LVQLVIETIEa 246 Agrobacteri...
Q13R55           173 LAEVAQIARDV--AASLGTMGVALTACTVPAAGKPGFELADGEVEWGLGIHGEPGVERGALEPAAA---VVDKLLEKIVg 247 Paraburkhol...
ACR27904         173 LAEVARQAREA--AAALGTMGVALSPCTVPAAGVPGFTLGEREIEWGLGIHGEAGVERAELDPAGAadtVAERLLARIAg 250 Burkholderi...
6_pfamImport     154 LAALVDMVNHLmeTNKVGTMGVAIKPCTLPGQQDNSREWGDREMEIGLGIHGEPGVTKCEQQDVPS---LCKMLLEKITs 230
CBN77364         192 LEEVLAETASA--SQNVGTLGVALTTCTLPGQE-PSSRLDADTIEIGLGIHGEAGITQTGLQTADE---LTDAMISAIVd 265 Ectocarpus ...
jgi:MICPUN_98137 173 LDLVAEEARAA--ASAVGTMGVASAAHKLPGADDPARAIPPGELEMGLGIHGEPGAFTAPAAPVAS---VVAKMLETIE- 246 Micromonas ...
EEF28649         179 LHEVAAEAKRA--SEMVGTMGVALSVCTLPGQV-TSDRLGPGRMELGLGIHGEAGAAVADLQSVEV---VVSHVLKQILs 252 castor bean
3PNM_A           245 V------------NgsyhrtlrfwdyqqgswqeeqqtkqplqsGDRVIALVNNLGATPLSELYGVYNRLTTRCQQA-GLT 311 Escherichia...
WP_015247210     247 da--------ppaP-----------------------------GERVALLINNLGATPTMELLIVARCALATLESL-GVQ 288 Singulispha...
Q1DEN7           248 dr--------ritS-----------------------------GDRVVLVVNGLGGTPPMELAIVARRALAALRQG-GIR 289 Myxococcus ...
AAK89855         247 dg--------klaG-----------------------------GNRVALLVNGLGATPPMELAIVARSAVARLEAK-GIV 288 Agrobacteri...
Q13R55           248 dl--------slqA-----------------------------GERVALLVNNLGGTPSSELNIVAGAALRYLAER-GIR 289 Paraburkhol...
ACR27904         251 dl--------aleR-----------------------------GARVALLVNNLGGTPPGELDIVAGAALRVLGAR-GVK 292 Burkholderi...
6_pfamImport     231 Dqmsmg---lalgD-----------------------------GSKCVLMVNNLGSTTAMELYVVAKYAAEALRAK-GIE 277
CBN77364         266 SesqggqdylplsA-----------------------------DQRVAVLVNNLGATPPMELMLIARRATSNLQGR-GAR 315 Ectocarpus ...
jgi:MICPUN_98137 247 -------------------------------------------KTKVCVMVNSLGSTPAMELHVAARCAREWLSSH-DLN 282 Micromonas ...
EEF28649         253 Letny----vpitR-----------------------------GNRVVLMVNGLGATPVMELMIAAGKAVPQLQLEhGLA 299 castor bean
3PNM_A           312 IERNLIGAYCTSLDMTGFSITLLKVD--DETLALWDAPVHTP 351 Escherichia coli K-12
WP_015247210     289 VERVYLGTFLSALEMAGVSLSVLRVD--DARLARLDAATEAP 328 Singulisphaera acidiphila
Q1DEN7           290 VERAWSGTFLSALEMPGCSLTLLKVD--DARLARLDAAVDAP 329 Myxococcus xanthus DK 1622
AAK89855         289 VERAWAGTFLSALDMPGFSLSVMQVD--DAALSLIDAPTEAG 328 Agrobacterium fabrum str. C58
Q13R55           290 TERAWAGTFLSALEMAGISLSLLRVD--DQRLGWLDAAAQTS 329 Paraburkholderia xenovorans LB400
ACR27904         293 VERAWAGTFLSALDMAGISLTLLRVD--DARLAWLDAPSAAP 332 Burkholderia glumae BGR1
6_pfamImport     278 PERVMVGSFMTALDMAGFSLSLWNSNgdAKMLALFDAFTSAP 319
CBN77364         316 VERVFCGSFMTSLDMAGASVTVMRVD--ALSLARLDAAADTP 355 Ectocarpus siliculosus
jgi:MICPUN_98137 283 PVRVYTGSFMTALDMTGFSITLCQVD--SARLARIDAPTGAP 322 Micromonas commoda
EEF28649         300 VDRVYTGSFMTSLDMAGFSISIMKAD--EAILQRLDAATKAP 339 castor bean
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap