1TU5


Conserved Protein Domain Family
Cu_amine_oxidN3

?
pfam02728: Cu_amine_oxidN3 
Click on image for an interactive view with Cn3D
Copper amine oxidase, N3 domain
This domain is the second or third structural domain in copper amine oxidases, it is known as the N3 domain. Its function is uncertain. The catalytic domain can be found in pfam01179. Copper amine oxidases are a ubiquitous and novel group of quinoenzymes that catalyze the oxidative deamination of primary amines to the corresponding aldehydes, with concomitant reduction of molecular oxygen to hydrogen peroxide. The enzymes are dimers of identical 70-90 kDa subunits, each of which contains a single copper ion and a covalently bound cofactor formed by the post-translational modification of a tyrosine side chain to 2,4,5-trihydroxyphenylalanine quinone (TPQ).
Statistics
?
PSSM-Id: 397028
Aligned: 12 rows
Threshold Bit Score: 98.5538
Threshold Setting Gi: 543747
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1TU5_A          152 RPVLLREYLDIDQMIFnrELPQAAGVLHHCCsYKQ--GGQKLLTMNSAPRGVQS----GDRSTWFGIYYNITKG----GP 221 cattle
XP_013933787    114 PILTVEDLCATEDVIR--NDPAVIEQCVLSGiPANemHKVYCDPWTIGYDERWGt---GKRLQQALVYYRSDEDd---SQ 185 Ogataea para...
O23349          119 PSFTFIELFKASKLPL--TYPPFKKSILDRS--LNi-SEVSCIPFTVGWYGETT----TRRELKASCFYRDGSV----NV 185 thale cress
Q9STI4          177 PIVTSEEMDSAASAPF--SNADFNRTINSRG--VNl-TDVICIPISSGWFGNKDd--nTKRVTKIQCFSTQDTP----NF 245 thale cress
Q8L742          175 PMMTIEEMNDITVVPF--SNADFNRTIISRG--VNl-TDVICFPISCGWFGNKEe---NARVIKSQCFMTQGTP----NF 242 thale cress
tigr:AAur_0579  110 lPVLLEEFGIIEDILA--VDPQWNAALASRG-LTp--AQVRVAPLSAGVFEYGNe--eGKRLLRGLGFRQDHPAd---HP 179 Paenarthroba...
wugsc:KPN_01467 215 gMVLLDDFVSVQNIIN--TSSEFAEVLKKHG-ITDp-GKVVTTPLTVGFFDGKDglqqDARLLKVVSYLDTGDG----NY 286 Klebsiella p...
KRH45608        199 PPMDAVEYAECEAVVK--DFPPFREAMKKRG-IEDm-DLVMVDPWCAGYHSEADa--pSRRLAKPLIFCRTESDcpmeNG 272 soybean
O70423          169 RPVLDREYQDIEEMIFhrELPQASGLLHHCCfYKH--QGQNLLTMTTAPRGLQS----GDRATWFGLYYNLSGA----GF 238 house mouse
O75106          165 RPVLRAEFTQMWRHLK--EVELPKAPIFLSS-TFNy-NGSTLAAVHATPRGLRS----GDRATWMALYHNISGV----GL 232 human
P36633          141 RPISTAEYDLLYHTLKraTMPLHQFFLDTTGfSFLgcDDRCLTFTDVAPRGVAS----GQRRSWFIVQRYVEG------Y 210 Norway rat
O42890          105 PIITADLLAITDEIVR--NDANVIEQCKICGvPESglSNVYCDPWTIGYDERYGs---GRRLQQALMYYKPGDSg---HL 176 Schizosaccha...
1TU5_A          222 YLHPVG-LELLVDHKALDPADWTVQKVFFQG 251 cattle
XP_013933787    186 YSHPLD-FCPIVDTEEKKVIFIDIPNRRRKV 215 Ogataea parapolymorpha DL-1
O23349          186 FTRPIEgITVTIDVDSMQVIKYSDRF-RKPI 215 thale cress
Q9STI4          246 YMRPIEgLTLLFDLDTKRILEITDTGQSIPI 276 thale cress
Q8L742          243 YMRPIEgLTILIDLDTKQVIEITDTGRAIPI 273 thale cress
tigr:AAur_0579  180 WAHPIDgLVAFVDIENRRVNHLIDDG-PVPV 209 Paenarthrobacter aurescens TC1
wugsc:KPN_01467 287 WAHPIEnLVAVVDLEAKKIIKIEEGP-VIPV 316 Klebsiella pneumoniae subsp. pneumoniae MGH 78578
KRH45608        273 YARPVEgIHVLVDMQNMVVLEFEDRK-LVPL 302 soybean
O70423          239 YPHPIG-LELLIDHKALDPALWTIQKVFYQG 268 house mouse
O75106          233 FLHPVG-LELLLDHRALDPAHWTVQQVFYLG 262 human
P36633          211 FLHPTG-LEILLDHGSTDVQDWRVEQLWYNG 240 Norway rat
O42890          177 RSIPLD-FCPIIDVDQKKVIAIDIPKVRRPI 206 Schizosaccharomyces pombe 972h-
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap