Conserved Protein Domain Family
DUF220

?
pfam02713: DUF220 
Domain of unknown function DUF220
This is family consists of a region in several Arabidopsis thaliana hypothetical proteins none of which have any known function. The aligned region contains two cysteine residues.
Statistics
?
PSSM-Id: 397020
Aligned: 29 rows
Threshold Bit Score: 114.65
Threshold Setting Gi: 1476375805
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q45GN9       102 SGSLPINLIVNENKKDLEVKYK--KEKMMFMKVFEGSWKIEPLYVDaDRLCKNMKPKSREEYKKCSGGQGKIAPK 174 thale cress
KRG99349     164 SGTISINVLVDQNRKDHSMKFM--QTKAGFMKKFEGCWRVEPLFVD-EAMCHPFKPVTKEDYNACTRGKGRIGSK 235 soybean
XP_009394240 170 SGTISVHVIVDQNRKDHTVKFQ--QGRSGFMKRFEGCWKVEPLFVD-EHLCQPFKPRTWDNYNTCTQGKGRVGSi 241 wild Malaysian banana
XP_015651484 160 SGVLSVHVFVDQNRTNHTVKFK--QGRTGFMKKFEGCWKIEPLFVD-KEACHPLDPCTLEKYDSCTNGTGRVGSs 231 Japanese rice
ERN02418     168 SGVMLVHVFVDQNRKDHTVKFK--QGKAGFMKRFEGAWKIDSNFVD-KDHSFPFEPKTITDYELCSNGKGRIGSv 239 Amborella trichopoda
EEF37005     165 SGTISVHVLVDQNRKDLTMKFK--QVKTGFMKQFEGCWRVEPVFID-QDICYPFKPKTWADYCWCTGGKGRIGSK 236 castor bean
CBI28544     161 SGTISVHVIVDQNREDHSMKFT--QVKTGFMKRFEGCWRVKPVFVD-EKSCFPFKPKTWDEYYSCTGGKGRIGSK 232 wine grape
Q9CAL6       164 SGTISVHVLVDQDRADHSMKFK--QVKSGFMKRFEGSWQVKPLFVD-EHMCDRLKPKTLEEYNRCTGGKGRIGSK 235 thale cress
Q9ZUD8       169 DGTCPIHLIVEENRKNLTSKYK--QETTMFMKVFEGCWKVEPLFID-EHLCDRSKPKSQKDYHSCSNGRGRIGSK 240 thale cress
RID46568     151 DGKMPIELVFNENRKDLLTLFRipREDVMNMEWLLGQLQIKPWYIDsDKYCTAREPKSAEEYRKCSGGKGLLGSK 225 field mustard
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap