Conserved Protein Domain Family
K_trans

?
pfam02705: K_trans 
K+ potassium transporter
This is a family of K+ potassium transporters that are conserved across phyla, having both bacterial (KUP), yeast (HAK), and plant (AtKT) sequences as members.
Statistics
?
PSSM-Id: 397017
Aligned: 52 rows
Threshold Bit Score: 523.228
Threshold Setting Gi: 52783008
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EEQ39632          40 AFSSLGAIYGDIGTSPLYVLNSIK--YPHATPTEEDIFGGISIIFYLFIIIVLAKYAFVVLTYGPNEGeGGQIAIYAKIA 117 Clavispora ...
Q5ZTN5            16 SFAALGVVFGDIGTSPLYAFGQVI---KYFPINDHNIYGILSLIFWSLIIIVSIKYLVIVFRADNDGE-GGIIALAGLIR 91  Legionella ...
Q5ZW98            11 aLGALGVVFGDIGTSPLYALKVTL---SGIPINQFNILGVLSLIFWSLIIIVSFKYLMIIFRADNDGE-GGILALLALMK 86  Legionella ...
Q5ZSY2            21 sLSALGIVYGDIGTSPLYTFKTVIllAGGGTPAVNTIMGSVSLIIWTLIIIASVKYIHFALRIDNDGE-GGILALMSLLS 99  Legionella ...
tigr:THEYE_A1816   4 VIKALGLVFGDIGTSPIYTLTVAF---LILEPTYENVLGVLSLIFWTLIILPTIQYNFLAMNLSIRGE-GGTIVLSEIFK 79  Thermodesul...
jgi:Ddes_2224     11 VIKSLGLVFGDIGTSPIYTLAVIF---MMTERTEANFIGILSLIIWTLLLLVTVEYAWLAMSLSKAGE-GGTIVLLSILR 86  Desulfovibr...
ACH40643          13 IVKALGLVFGDIGTSPIYTLTVVF---TLTKPTHANVYGILCLVFWTMTILVTAEYAWLAMSLGKKGQ-GGEIVLREIII 88  Geobacter b...
jgi:Mboo_1365      4 VVKSMGLVFGDIGTSPIYTFTAIF---LLIPPTPQNVMGILSLIFWTLTILVTVQYTFLAMHMGKKGE-GGTIVLKEILL 79  Methanoregu...
Q8TL61            10 IINSMGLVFGDIGTSPIYTLTVIF---LLTRPTEVHVIGVLSLIIWTLITLVTVEYAWLAMSLGKKGE-GGTIVLKELLV 85  Methanosarc...
Q54JK9            60 SITAIGCIFGDIGTSPLYVYASMF----KGPPGEKEVIGSLSLILWALIMVVTVKYVVFILNADNNGE-GGIIALVSLIP 134 Dictyosteli...
EEQ39632         118 rhlhfgpkgviipgspqrsdlellkrvettnsfMSSKSQGGWKkkpsvikfisafTLIVCFLGCALVISDGLLTPTTSVL 197 Clavispora ...
Q5ZTN5            92 ---------------------------------QKIKKPGGWL------------LF-ITLVGIGLIIGDGILTPAISIL 125 Legionella ...
Q5ZW98            87 ---------------------------------HKSTKY-QPL------------FYIVAIFGAGLLLGDGMLTPAISVV 120 Legionella ...
Q5ZSY2           100 ----------------------------------LKLKQRPFI-------------IAVGLMGAALIYGDGTITPAISVL 132 Legionella ...
tigr:THEYE_A1816  80 s-------------------------------lSKSNKTKAFV-------------TFLALIGVSFLIGDGVITPAISIL 115 Thermodesul...
jgi:Ddes_2224     87 p-------------------------------mLQSGKKIGVA-------------SVLAFIGVSLLVGDGVITPAITIL 122 Desulfovibr...
ACH40643          89 k-------------------------------lFKQGRVLAFA-------------GFLSFLGVSLLLGDGVITPAISIL 124 Geobacter b...
jgi:Mboo_1365     80 p-------------------------------mLKSGNQIAFV-------------SLLSIIGISLFIGDGVITPAISIL 115 Methanoregu...
Q8TL61            86 p-------------------------------lIKSGRNAAFI-------------TLLAYIGVSFLVGDGVITPAISIL 121 Methanosarc...
Q54JK9           135 ---------------------------------KQTNQKLKSA------------LTILALCGSSFILGDGVITPAVSLL 169 Dictyosteli...
EEQ39632         198 SAVAGIQVAKPSFS-----HVLAVSEVILVFLFFIQQFGSATISYFFAPIIAVWLVGLIICGAINISHHPSVLKSLSPHY 272 Clavispora ...
Q5ZTN5           126 SAVEGLESLSPNLAk----YVLPVTLIILFFLFKMQSIGTGKIGIYFAPVMLIWFITIGVLGFLQIIQNPKVLMAINPYY 201 Legionella ...
Q5ZW98           121 SAVEGLGTLSDKLYp----YVLPIASVILVLLFSLQAKGTARIGYLFGPLILIWFITIAILGILQIVEHPVVLQAINPYH 196 Legionella ...
Q5ZSY2           133 SAVEGLEILSPSLKy----YVLPIAITILITLFAIQSKGTATIGKAFGPVMAFWFLTIGILGARGVIQHPSVLAAINPIY 208 Legionella ...
tigr:THEYE_A1816 116 SAVEGTA-FIPGLEgisqaSMVFIAIIIAFTLFLFQKKGTEKVSSAFGPIMCIWFLSILVIGIHSVFLNPQVLKAINPYY 194 Thermodesul...
jgi:Ddes_2224    123 SAVEGL-VLLPGLEdvsqgTLVVLALLVAVFLFSIQKNGSSRLSAFFGPVMAVWFGVLACSGLAALSQFPAVLKAVNPWY 201 Desulfovibr...
ACH40643         125 SAVEGL-LLIPGLEatrqgVLVVIAALIAFTLFFFQSRGTDKMAGVFGPIMILYFGSLLVSGLVSISGTPGIVAAINPMY 203 Geobacter b...
jgi:Mboo_1365    116 SAVEGV-LLIPGFEqtaqiFLMLAAAIITICLFAFQARGTEKVAWAFGPVMVVWFAVLAVSGVVALCLAPQVLFAVNPMY 194 Methanoregu...
Q8TL61           122 SAVEGLR-IIPDFQdigqgAIMFIAGIIAVALFSVQSKGTEEITWVFGPVMVLWFASLAFSGIASIFYTPGVLRAINPYY 200 Methanosarc...
Q54JK9           170 SAVEGLEVGVPGGEik--kWIVPITVVILFFLFVVQSFGTEAIGIVCGPIMILWFFSIGIFGLLKVIDHPIVFRAFNPWE 247 Dictyosteli...
EEQ39632         273 AIRLLKR---SGVDAFGGSMLAITGTEAMFADLGHFGKVPTQIGIST-VLFALIITYLGQGAYVIKRP-ESLPNVFYESI 347 Clavispora ...
Q5ZTN5           202 AIYFFMIhkyFALFILGGVFLVMTGGEALFADLGHFGKKAIRTGWFAvALPALLLCYFGQGAFVLMHI-EYIKYPFFSLS 280 Legionella ...
Q5ZW98           197 AIAFLVDeglRGYFLLGGIFLVVTGGEALFADIGHFGKNPIRFSWFFiALPCLLLNYFGQGANLIVRP-EEISNPFFMIA 275 Legionella ...
Q5ZSY2           209 GLSFLFSngaTGFFILCGVFLCVTGAEALYADLGHFGTAPIRCAWFGlAFPSLIFNYLGQAALVLEGA-STEHNIFYMLC 287 Legionella ...
tigr:THEYE_A1816 195 AVEFLMHngwKGYLVLGEIILCATGAEAMYADMGHLGAKPIRKAWAM-VFFALFINYFGQGAFLLKNPq--vKNILFEMA 271 Thermodesul...
jgi:Ddes_2224    202 GIDFMLRnglAGFFVLSEVILCATGGEALYADMGHMGRKPILAAWGM-VFTALLLCYMGQTAFLVHNPg--aNNVLFEMV 278 Desulfovibr...
ACH40643         204 AIDFFREngiAGYFVLSEVILCSTGGEALYADMGHLGKKPIIRAWYF-VFAALYLNYLGQGAFLLKHPd--tKNILFGMI 280 Geobacter b...
jgi:Mboo_1365    195 AADYLLHnglAGFLILSSVILCATGGEALYADMGHLGREPIVKAWHL-VFFALVINYFGQGAFLMANPn--sQNVLFDMI 271 Methanoregu...
Q8TL61           201 AISFLLHngfTGFFVLSEVILCATGGEALYADMGHLGREPILKAWRL-VFSALVLNYLGQGAFIIRNPe--sKNILFEMI 277 Methanosarc...
Q54JK9           248 GIQHFLLngsRGFLLLGTVILCVTGCEALYADLGHTGKMPIRLSWVLiVMPSLMLNYLGQASQFLGNPnT--SNPFFEMI 325 Dictyosteli...
EEQ39632         348 -PGgtnsWFYWIMF-VLAILSTIIASQALILGVFSILSQMINLDCFPKLRVVHVSSSYVGKVYIPMANLLLLIGVCATTA 425 Clavispora ...
Q5ZTN5           281 -PD----WF-LPVMiILATIATIIASQAIISAAFSILKQASLLNLIPRLKIIYTSKFEKGEVYLPLINFILALGTCSLVV 354 Legionella ...
Q5ZW98           276 -PP----WFYLPLI-IIATVATVIASQAVISATFSLTKQAVLLGLCPKIPIVQTSMLHSGQIYVPQINFILFIGTMAFCL 349 Legionella ...
Q5ZSY2           288 -PG----DFLLPLI-ILSTVATIIASQAIITGAFSMTRQAMQLGWLPRLRVTQTSSEGYGQIYIGVVNWLLMLATLGLTI 361 Legionella ...
tigr:THEYE_A1816 272 fNFs--sFLYVPFL-ILSLLATVIASQAMISGMFSVVYQAITTRIMPMLKIDYTSKELKSQIYIGSVNWFLLLAVILIMI 348 Thermodesul...
jgi:Ddes_2224    279 hSQa--rWLYAPFL-VLSLLATIIASQSLISGIFSIMYQSMATHIMPLFKVDYTSREMHSQIYIGSVNWALFLAVVLVIM 355 Desulfovibr...
ACH40643         281 qEQs--sLLYIPFL-LLTIMATIIASQSIISGVFSIVYQGITTRLMPLFKVDYTSKHIQSQIYIGVVNWTLMCAVIFVMF 357 Geobacter b...
jgi:Mboo_1365    272 fSEa--kFLYIPFL-LLSIAATVIASQAMISGIFSIVYQGITTRILPLLHIEYTSPHLRSQIYIDVVNWMLLFAVLLVIM 348 Methanoregu...
Q8TL61           278 nQQa--eVIYIPFL-ILSITATIIASQAMISGMFSIVYQGITTRIIPMLKIDYTSGKLRSQIYIGAVNWLLLISVLFMIF 354 Methanosarc...
Q54JK9           326 -PT----SFFWPMI-ILATVACVIASQGLISGSFSIINQVISLKFFPPLHVKHTSKKISGQIYIAQVNWVLAFLTLITVI 399 Dictyosteli...
EEQ39632         426 GFKNSNNVTAAYGLGISLDFLLTSLLLMVCFVYVY-EYQWWVSAIYCLIFVPLEVCIIISNIKKVPHGGWFPLMMCAIFF 504 Clavispora ...
Q5ZTN5           355 IFKSSSNLADAYGIAVNLDMLITTVLVGIIAYYCW-NWHAFKVMIFPLIL-VIELAFFAGNIPKLLTGGWIPILIAFLGF 432 Legionella ...
Q5ZW98           350 AFKTSDNLAHAYGIAVNLEMLLVDAMVAYAAVSIW-RWSTFNVIFLFGLFLLIDLAFLGANTHKFITGGWVPIVLAFFIA 428 Legionella ...
Q5ZSY2           362 GFGSSEKLAAAYGIAVSATMLCTTLLLFIALHKLW-KWDIITSGLVAGLFMIVDASFFAANLTKFINGGYIPITLAIIIY 440 Legionella ...
tigr:THEYE_A1816 349 DFGSSSNLAAAYGLAVTGNMCITGLLL----VSIFfLKRNYYAMLASIFIIFVDFVYFSSCLYKIPHGGYWSIILALFPF 424 Thermodesul...
jgi:Ddes_2224    356 GFKESHRLAAAYGLAVTGTMTITGMLMVWIFH----LKNRPWLCATAAGICALDVVYLVANFYKLPHGGYWSLVIAMIPL 431 Desulfovibr...
ACH40643         358 FFQKSVNLAAAYGMAVTGSMTITALMMIMVFSKTTkKWKVPVVAVIAV----IDLIYFTSTFPKFVHGAYWSIALASVPF 433 Geobacter b...
jgi:Mboo_1365    349 VFRSSNSLTHAYGLAVCGTMMITSIFILWILVLRG----ELIKSIIAGGVLVVTTSFLISNLHKIPSGGYWSLIIAAIPL 424 Methanoregu...
Q8TL61           355 EFRDSHRLAAAYGLAVTGTMSITGLMMTLIFYLKG----RMFRSFVSLFVTVIDVVFLLSNTYKIPHGGYWSIVIAAIAF 430 Methanosarc...
Q54JK9           400 GFKHSSSLIGAYGLGVSMVMIATTIMYIFVLRLHF-RYSYWVIVPLGLCFIIMDGLFFTSSIEKIPTGGWYPIVIGIVMS 478 Dictyosteli...
EEQ39632         505 SIFAFWRYCRSKTVEKqltsrvritdifpllkgkpastvvdlghksyvdstdiSMNEA-DLSERETVEDEpnQDVKfder 583 Clavispora ...
Q5ZTN5           433 VVMYTWHCGFEKLREL-------------------------------------HHRDAlMDAFIIDELNQ--NKIS---- 469 Legionella ...
Q5ZW98           429 FIMYSWRYGLEYLRDN-------------------------------------FYMNKeDISKILKQLQY--KSLN---- 465 Legionella ...
Q5ZSY2           441 SMMYIWHKGYQTIAIK-------------------------------------QKEKNiTVASFLDSIQK--ERVV---- 477 Legionella ...
tigr:THEYE_A1816 425 LTMFIYMRGQKRLYRFmm---------------------------------------fmPLDDFILKFERvyETNP---- 461 Thermodesul...
jgi:Ddes_2224    432 GIILIYTQGQKAVY---------------------------------------QRMQPmPRDVFMERFTKlrRQGH---- 468 Desulfovibr...
ACH40643         434 ITIQVWTKGQRQLYRAl-----------------------------------rPLDLDiFMLSYEQIYGK----NK---- 470 Geobacter b...
jgi:Mboo_1365    425 GIILIYTNGQRQLA---------------------------------------SSLKPvPIEDFLPEFNKvyASVN---- 461 Methanoregu...
Q8TL61           431 SLIIIYTSGQKKLYELm-----------------------------------nPMKIGdFLEKYKQVYAS----EN---- 467 Methanosarc...
Q54JK9           479 SIMLIWRYGRSKMIKV-------------------------------------IHDSSpPLSTTLQQVDL--LNRG---- 515 Dictyosteli...
EEQ39632         584 spfklvstnygnvelsTKPGV-AIIYSDNPyndlsspNSVPGVYERI-VRSCASIPSVVIFCTIRVLSIPTVASEDRILV 661 Clavispora ...
Q5ZTN5           470 ----------------RQSGM-GLYIIDPY-------DCEGESLLHH-LRLNRIFFENMIFVSIKIENKPYIPIEDKFEL 524 Legionella ...
Q5ZW98           466 ----------------QLPGVsAIFITDVY-------DKSGGSFLHF-LKLNRSVPENVLIVNYIVDNIPYVHYSQRYEI 521 Legionella ...
Q5ZSY2           478 ----------------RVPKT-AVFLTSKE-------QDIPPILVWH-VKKNHVLQDKVIILKINNLSIPRCKPGDRLQI 532 Legionella ...
tigr:THEYE_A1816 462 ----------------KIPGT-AIFFIRDK-------NKISPYIVETmFYH-GIIYEDNIFLSIVIR---PDPFGVTGYF 513 Thermodesul...
jgi:Ddes_2224    469 ----------------IIKGT-AIFFLRSL-------DSISPYICKTmFD-NGIIYERNVMLSISRT---YEPQGLECRF 520 Desulfovibr...
ACH40643         471 ----------------NIPGT-ALFFLKAL-------DVIPPYIVHCmIRS-NIIYERNILISIIRT---DEPFGNIARH 522 Geobacter b...
jgi:Mboo_1365    462 ----------------KISGS-ALYFARDF-------RRLPQYIPRTmFV-NNIVYEENIVISIIRT---EQPFGVTWGV 513 Methanoregu...
Q8TL61           468 ----------------KISGT-ALFFARDI-------NYVPRYISNVmFE-NNIIYEDNIFISIIKC---ESPFGVKSSF 519 Methanosarc...
Q54JK9           516 -------------------DA-AVFMSHYE-------EKTPLSLVKL-QPFLTHMPYPLFFVNIYHLPVPFIKDEHRVVA 567 Dictyosteli...
EEQ39632         662 G-ATKi-PGHYNCILRFGFME 680 Clavispora lusitaniae ATCC 42720
Q5ZTN5           525 I-KKA--EGFYLIFIHYGFTE 542 Legionella pneumophila subsp. pneumophila str. Philadelphia 1
Q5ZW98           522 V-CLD--EKVCKLVIHYGFME 539 Legionella pneumophila subsp. pneumophila str. Philadelphia 1
Q5ZSY2           533 V-ETG--TGIWHAVANYGFME 550 Legionella pneumophila subsp. pneumophila str. Philadelphia 1
tigr:THEYE_A1816 514 KeNLC--KGVRVFEIQMGYME 532 Thermodesulfovibrio yellowstonii DSM 11347
jgi:Ddes_2224    521 E-DTHv-AGIQVFTVTAGYME 539 Desulfovibrio desulfuricans ATCC 27774
ACH40643         523 KkDVG--TGLEFFQISAGYME 541 Geobacter bemidjiensis Bem
jgi:Mboo_1365    514 TrELT--KGLSIFEIYLGYME 532 Methanoregula boonei 6A8
Q8TL61           520 AkDLA--KGLRVFEINVGYME 538 Methanosarcina acetivorans C2A
Q54JK9           568 K-ELIpeRGVFQISINYGYAE 587 Dictyostelium discoideum AX4
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap