6III


Conserved Protein Domain Family
UPF0061

?
pfam02696: UPF0061 
Uncharacterized ACR, YdiU/UPF0061 family
Statistics
?
PSSM-Id: 397009
Aligned: 56 rows
Threshold Bit Score: 558.676
Threshold Setting Gi: 575431444
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6III_A                5 MTLSFITRWRDELPATYTTLSPTPLNNARLIWHNAElANTLGIpsslFK--NGAGVWGGEtl----lPGMSPlAQVYSGH 78 
Q87R88                5 qrvsfthRFSQLPSAFYTLVEPQPLDNTRWVAWNGEfAQQFGLp--aAQndELLAVFSGQse----fEPFRPlAMKYAGH 78  Vibrio p...
Q5E3Y2                5 nslsitTRYSRLPRCFFTYVQPTPLDNSRWLIWNSElAKQFDLpenvHNhsELLDAFSGEtv----pSVFSPlAMKYAGH 80  Aliivibr...
goetting:MIM_c16670   5 SNLQVSNRFASLSPAFYTRLRMQGLTDPTLLHVNPDvLASLGLtmedARspAFLSIMSGNad----lPGGVTlSAVYSGH 80  Advenell...
CAX59424              1 --mqftNTWHQELEGFYTALTPTPLKNPRLLYHSAGlAAELGLddswFAadK-IGIWSGEsl----lPGMQPlAQVYSGH 73  Erwinia ...
ESQ07750             39 adqedTNHIRQVYQAVYSPVNPTPVKKPHLVAWSPEaAALIDLveadCRsaLFTDIFVGNql----lPGMQPfAMNYGGH 114 uncultur...
CCK69847             47 LKLFHTPHIVTKGSHFSYNIPERRANYKPLIVSEKAl---YDLn--lLSdeTGMKLFSGQevycsveKNIFPySLAYAGF 121 Kazachst...
CCD25464             50 VEKFHTPRYVSSGSHFSFTTPMKRSHYKPILVSKETlENDFQLd--iENdpLIPKILSGEkiyydedKSIFPySLAYAGY 127 Naumovoz...
XP_003673044         50 ITAFHTPRFVSPGSHFSFTTPFQRPHYKPLLVATDTlRDEFQLd--pTTdpNLTKILSGAkvy--ytDTIFPySLAYAGY 125 Naumovoz...
XP_003957857         50 IKAFHTPRIVSKGSHFAFCLPTKRQYVRCLINSRNA-LDDFNLs----LddNLIKIFNGEkvyydkeKNIFSySLAYAGF 124 Kazachst...
6III_A               79 QFGVWAGQLGDGRGILLGEQRLAD--GTTMDW--HLKGAGLTPYSRMGDGRAVLRSTIRESLASEAMHYLGIPTTRALSI 154
Q87R88               79 QFGVYNPDLGDGRGLLLAEIEHQN--GTWFDI--HLKGAGLTPYSRMGDGRAVLRSTIREYLCSEAMAGLGIPTTRALGM 154 Vibrio p...
Q5E3Y2               81 QFGCYNPDLGDGRGLLLAEIKDKK--GNSFDL--HLKGAGLTPYSRSGDGRAVLRSTIREYLCSEAMAGLGIPTTRALGM 156 Aliivibr...
goetting:MIM_c16670  81 QFGVWAGQLGDGRAHLLGAISGTDdnGKPADWeiQLKGSGRTPYSRMGDGRAVLRSSVREYLASAAMTGLGIPTTQALCL 160 Advenell...
CAX59424             74 QFGVWAGQLGDGRGILLGEQRLED--GRKMDW--HLKGAGLTPYSRMGDGRAVLRSSLREFLASEAMYHLGVPTSRALTV 149 Erwinia ...
ESQ07750            115 QFGNWAGQLGDGRAINLGEVLNHR--KEHWTL--QLKGAGLTPYSRSADGRAVLRSSLREYLCSEAMHHLGIATTRALSL 190 uncultur...
CCK69847            122 QFGEFAGQLGDGRVVNLFQLQDRM--DQTQTL--QLKGSGMTPFSRFADGKAVLRSSIREFIISECLYHIGIPSTRSLQL 197 Kazachst...
CCD25464            128 QFGSFAGQLGDGRVVNLFDYMN-------HTF--QLKGSGKTPFSRFADGKAVLRSSIREFIISEALYNIGIPSTRAVQL 198 Naumovoz...
XP_003673044        126 QFGSFAGQLGDGRVHNLFSLNN-------QVF--QLKGSGITPFSRFADGKALLRSSIREFIISGALHAMNVPSTRALQL 196 Naumovoz...
XP_003957857        125 QFGEFAGQLGDGRLVNLFDLPDKS--KTYQTF--QLKGCGITPFSRFGDGKAVLRSSIREFIISEALFNIGIPSTRAIQL 200 Kazachst...
6III_A              155 VT-SDSPVYRE-------TV--EPGAMLMRVAPSHLRFGHFEHFYYRREPEKVRQLADFAIRH----------------- 207
Q87R88              155 VV-SDTPVYRE-------KT--EFGAMLIRMAETHVRFGHFEHLFYTNQLAEQKLLADKVIEW----------------- 207 Vibrio p...
Q5E3Y2              157 MT-SDTPVFRE-------GY--ETGALLIRMAETHIRFGHFEHLFYSNLLEELKLLSDKVIEW----------------- 209 Aliivibr...
goetting:MIM_c16670 161 VA-SDDPVYRE-------TV--ETAAIVARVAPSFVRFGSFEHWYAAKDAARLRELLDYVISN----------------- 213 Advenell...
CAX59424            150 VT-SDEPVYRE-------TT--ERGAMLLRVAESHLRFGHFEHFFYNQQPEKVRELADYAIRH----------------- 202 Erwinia ...
ESQ07750            191 IL-TGEAVVRDmfydghpAS--EPGAVVCRMSPSFVRFGNFEIHAVRKEVELLRTLADFTIGA----------------- 250 uncultur...
CCK69847            198 TLlPGTKAMRS-------SL--ETCAVVCRFAPSWIRIGNFDLFRWKADLPGLVKLADYCIEDvfqnfmnssngvsltvf 268 Kazachst...
CCD25464            199 TLlPGTKAIRD-------GS--EPCALVCRVAPSWIRFGSFDLFKWKPNLVGLIKLTDYCIEDvfhngegfpkdidlakf 269 Naumovoz...
XP_003673044        197 TLlPGTRALRE-------GGrrEPCAVVCRVAPSWIRLGSFDMFKWRPHLPGLVKLTDYCIDEvfqsgkdfprelnwnrf 269 Naumovoz...
XP_003957857        201 SSlPGTKALRN-------GM--EPCAVVCRFAPSWIRLGNFNLFRRRPDPKGLVALSDYCIENvfdngrgfpkdidlnhf 271 Kazachst...
6III_A              208 ---YWShl---aDDE--------------------DKYRLWFTDVVARTASLIAQWQTVGFAHGVMNTDNMSLLGLTLDY 261
Q87R88              208 ---HFAdc---aSAE--------------------KPYAAMFGEIVQKTADMIAYWQAYGFAHGVMNTDNMSILGQTFDY 261 Vibrio p...
Q5E3Y2              210 ---HFPcc---lGED--------------------KPYLAMFNNIVDRTAYMIAQWQAVGFAHGVMNTDNMSIIGQTFDY 263 Aliivibr...
goetting:MIM_c16670 214 ---FFAdqvpavDSEht----------------lnDVIERFVDIVIERTATLMAGWQSVGFNHGVMNTDNMSVLGLTLDY 274 Advenell...
CAX59424            203 ---HWPqw---qDEE--------------------DRYRLWFTDVVRRTARLIAHWQSVGFAHGVMNTDNMSILGLTLDY 256 Erwinia ...
ESQ07750            251 ---DFPhl---lAEKgd-----------------tERYVQWLAEIARTTGELIAQWMRVGFVHGVMNTDNMSILGLSIDY 307 uncultur...
CCK69847            269 gkdFFPd----eDQQknitptikqsddntpliedqSKYDQFFRHVVNLNAECVAHWQAYGFLNGVLNTDNTSILGLSIDF 344 Kazachst...
CCD25464            270 nkdYFPds---kDEEnisssslheekqdqeqkeglTNYDQFFRHVVNLNAECVAYWQAYGFCNGVLNTDNTSIMGISLDY 346 Naumovoz...
XP_003673044        270 drdYFP------DEEgqasasc------slplddvSQYDLFFRHVVNLNANTVAFWQAYGFCNGVLNTDNTSIMGLSMDF 337 Naumovoz...
XP_003957857        272 trdYFPd----aDENvaaeehs-------klrdglTKYALFFRHVVNLNAECVAYWQAYGFLNGVLNTDNTSIMGISMDF 340 Kazachst...
6III_A              262 GPFGFLDDYEPGFICNHSDHQG-RYSFDNQPAVALWNLQRLAQTLSPF-V-----------------AVDALNEALD--- 319
Q87R88              262 GPFGFLDDYEPGYICNHSDYQG-RYAFEQQPRIALWNLSALAHALSPL-V-----------------EREDLEQALS--- 319 Vibrio p...
Q5E3Y2              264 GPFGFLDDYEPGYICNHSDYQG-RYAFNQQPRIGLWNLSALAHSLSPL-I-----------------DKSDLEKALE--- 321 Aliivibr...
goetting:MIM_c16670 275 GPYGFMDAFRINHVCNHTDTQG-RYAWNAQPSVGLWNLYRFANCFVALgA-----------------EPDRLKARLE--- 333 Advenell...
CAX59424            257 GPYGFLDDYKPDFICNHSDYQG-RYSFENQPVVGLWNLNRLAHALSGL-M-----------------TTEQLKQALA--- 314 Erwinia ...
ESQ07750            308 GPYGWLEGYDPTWTPNTTDSEGrRYCFGNQPYIGQWNLMQLANALYPLvQ-----------------AAEPLQEAVD--- 367 uncultur...
CCK69847            345 GPFNFLDKFQPDFTPNHDDYAK-RYCFANQPGIMWWNLAQLAQALAIL-Igpgetfl----qkvlegGFEGLDKDMEgki 418 Kazachst...
CCD25464            347 GPFSFLDKFEPDFTPNHDDYTK-RYSFANQPSVIWWNLIQLAQDIAVL-LgagpkhindilqmqngeDIDKFDDDLEkef 424 Naumovoz...
XP_003673044        338 GPFSFMDIFDPDFTPNHDDFTK-RYSFANQPGVIWWNLLQFAQDIAIL-Lgagtehle-kvvtlkqeDINALENQYEekf 414 Naumovoz...
XP_003957857        341 GPFNFLDRFQPDFTPNHDDSMK-RYSFENQPGVILWNLIQFAQDIALL-Lgadesmi----gniteiDLTKLDDGTEakm 414 Kazachst...
6III_A              320 -------------SYQQVLLTHYGQRMRQKLGF----------------MTEQKEDN---ALLNELFSLMARERSDYTRT 367
Q87R88              320 -------------QFEGRLSQQFSRLMRSKLGL-------------------KTKIAedgRLFESMFELLNQNHTDYTRF 367 Vibrio p...
Q5E3Y2              322 -------------QYEIKLHDYFSQLMRKKLGL-------------------LSKQEgdtRLFESMFELLSQNAVDYTRF 369 Aliivibr...
goetting:MIM_c16670 334 -------------RYEGLFISAYRDRMIAKLGL-------------------QAWQEgddDLIDGWWRVLHDQSADFTLS 381 Advenell...
CAX59424            315 -------------EYEPELMRCWGQQMRAKLGF-------------------TTQGKhdnDILTGLLALMTKEGSDYTWT 362 Erwinia ...
ESQ07750            368 -------------EYRTTFQSRWQQIVHEKLGL-------------------ENSEEgdaALINDLFELLTKTETDYTIF 415 uncultur...
CCK69847            419 irraneiirccgnEYKFRFTTKYADIMAKRLGIdlnidfkdckdassveRTAEVVREfcsTFVEPLLEILQRTQIDYNMF 498 Kazachst...
CCD25464            425 vnrannmirlcssEYKYRFTTKYADLMGKRLGIdldlpkkl-tndvdldKLSIEIQEfstFIIDPLLEILQHTKIDYNNF 503 Naumovoz...
XP_003673044        415 vkrvnkviklassEYKFRFTTKYAQLMSERLGIdlkllperlddetdleQLSEKIREfcsVIVEPLLQILQSTKVDYNHF 494 Naumovoz...
XP_003957857        415 lerlnkiirlsvnEYKFHFTAKYGDLFAKRLGIdlgidisnctdqtsiqRVAEVITEfcsVIVEPLLKILQTTKIDYNNF 494 Kazachst...
6III_A              368 FRMLSLTEQHSAA-SPLRDEf-----------------IDR--------------------------------------- 390
Q87R88              368 FRALSNLDKQPAQe------------------------VIDlfi------------------------------------ 387 Vibrio p...
Q5E3Y2              370 MRALSYLDSQDKQt------------------------VVDlfv------------------------------------ 389 Aliivibr...
goetting:MIM_c16670 382 FRYLAQIDVDEs-------------------------pLRSlft------------------------------------ 400 Advenell...
CAX59424            363 FRQLSDSVQQGSTs-----------------------pLRDefi------------------------------------ 383 Erwinia ...
ESQ07750            416 FRRLTLI-------NPADNEpcndplaqllpayyqpdtLDDey------------------------------------- 451 uncultur...
CCK69847            499 FVRLQNFTGSITSsDSVNSMk----------------gLSTaylelffdekqlailka----------qnsypidaakeh 552 Kazachst...
CCD25464            504 FVNLQSYDGPFFVnDEGNLFn----------------gLDEdfikiffkdeemrkikefyekasgdlnrttsrdsgetrf 567 Naumovoz...
XP_003673044        495 FVNLQDYQGNFFD-SSSNSId----------------gLDElyislffkdeqlkklieyyqv---enkkyqsqsdgeirq 554 Naumovoz...
XP_003957857        495 FVNLQNYQGNFFD-TDTTAFa----------------gLDKefvsiffnesqieqllrfek-----drksqlsnngeirl 552 Kazachst...
6III_A              391 -----AAFDDWFARY--RGRLQQDe----vSDSERQQLMQSVNPALVLRNWLAQRAIEA------------AEKGDMTEL 447
Q87R88              388 ---drEAAQAWLDLYlaRCELEVDeigepiSAEQRSEQMRQTNPKYILRNYLAQLAIDK------------AEEGDFSEV 452 Vibrio p...
Q5E3Y2              390 ---drEAATLWIDLYltRCKLEVD------SFDMRCSKMRKVNPKYVLRNYLAQQAIVK------------ANEGDFSDV 448 Aliivibr...
goetting:MIM_c16670 401 ---dtTRLEQWLASY--RKRLQDNen---dSAQARAGRMDQVNPLYVLRNYLAEEAIQA------------AAKGDMSVT 460 Advenell...
CAX59424            384 ---drEAFDSWYNIW--RQRVLEEe----rSDEDRQQQMKQANPAIVLRNYLAQQAIEQ------------AEKDDISVL 442 Erwinia ...
ESQ07750            452 ----rAAACRWISRY--RARLARNq----iPNEQRVLLMNRTNPKYVFRNYLAQMAIDK------------VEQGDFGLL 509 uncultur...
CCK69847            553 lddtlDLVIEWTEAY--QALIP--------NPEEKIKISGKVNPLFTPRSWIFNQVIDDlvvrqkdllddpKAKLDTSLL 622 Kazachst...
CCD25464            568 lirtmDKLKEWCISY--CRLVP--------DAEIRKSVAKKKNPLFIPRSWIFEEVIDNltleqrekldypEADLDTSLL 637 Naumovoz...
XP_003673044        555 vlslfNDLKEWTKIY--KEFIPI-------DYETRRTISSKVNPLFIPRSWIFNEVIDDltqrqadklndtDADLDLSLL 625 Naumovoz...
XP_003957857        553 mkdilEDLKAWTKCY--TDLVT--------NHQVRREIARKFNPLFIPRSWIFDQVIDDltirqkdvlenpDSELDTSLL 622 Kazachst...
6III_A              448 HRLHEALR 455
Q87R88              453 HRLAEILR 460 Vibrio parahaemolyticus RIMD 2210633
Q5E3Y2              449 KILSTLLA 456 Aliivibrio fischeri ES114
goetting:MIM_c16670 461 DSLLQVLR 468 Advenella mimigardefordensis DPN7
CAX59424            443 SRLHQALS 450 Erwinia billingiae Eb661
ESQ07750            510 TELHEVLR 517 uncultured Desulfofustis sp. PB-SRB1
CCK69847            623 RKLCLMSS 630 Kazachstania naganishii CBS 8797
CCD25464            638 QKLHLMSL 645 Naumovozyma dairenensis CBS 421
XP_003673044        626 NKMYLMST 633 Naumovozyma castellii CBS 4309
XP_003957857        623 QKLHLMSS 630 Kazachstania africana CBS 2517
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap