Conserved Protein Domain Family
UPF0060

?
pfam02694: UPF0060 
Uncharacterized BCR, YnfA/UPF0060 family
Statistics
?
PSSM-Id: 111577
View PSSM: pfam02694
Aligned: 4 rows
Threshold Bit Score: 133.36
Threshold Setting Gi: 3183475
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P9WFN9   2 VVRSILLFVLAAVAEIGGAWLVWQGVREQRGWLWAGLGVIALGVYGFFATLQPdAHFGRVLAAYGGVFVAGSLAWGMALD 81  Mycobacterium tubercu...
Q55939   2 ILRSLLYFVMAGLCEIGGGYLVWLWIREGKSVWLALVRAILLTVYGFVATLQP-ANFGRAYAAYGGIFIILSIIWGWQVD 80  Synechocystis sp. PCC...
O31553   2 MLITILLFLAAGLAEIGGGYLVWLWLREAKPAGYGIAGALILIVYGILPTFQSfPSFGRVYAAYGGVFIVLAVLWGWLVD 81  Bacillus subtilis sub...
P76169   1 MIKTTLLFFATALCEIIGCFLPWLWLKRNASIWLLLPAGISLALFVWLLTLHP-AASGRVYAAYGGVYVCTALMWLRVVD 79  Escherichia coli K-12
P9WFN9  82 GFRPDRWDVIGALGCMAGVAVIMYAP-RG 109 Mycobacterium tuberculosis H37Rv
Q55939  81 NVVVDRLDWLGAAIALVGVLVMMYAN-RA 108 Synechocystis sp. PCC 6803 substr. Kazusa
O31553  82 RKTPDLYDWIGAFICLIGVCVILFAP-RG 109 Bacillus subtilis subsp. subtilis str. 168
P76169  80 GVKLTLYDWTGALIALCGMLIIVAGWgRT 108 Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap