Conserved Protein Domain Family
VacA

?
pfam02691: VacA 
Vacuolating cyotoxin
This family consists of Vacuolating cyotoxin proteins form Proteobacteria. These proteins are an important virulence determinate in H. pylori and induce cytoplasmic vacuolation in a variety of mammalian cell lines.
Statistics
?
PSSM-Id: 111576
View PSSM: pfam02691
Aligned: 2 rows
Threshold Bit Score: 1697.99
Threshold Setting Gi: 2499108
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q48253   43 AFFTTVIIPAIVGGIATGAAVGTVSGLLSWGLKQAEQANKAPDKPDKVWRIQAGRGFDNFPHKQYDLYKSLLSSKIDGGW 122  Helicobacter pylori
Q48245   34 AFFTTVIIPAIVGGIATGTAVGTVSGLLGWGLKQAEEANKTPDKPDKVWRIQAGKGFNEFPNKEYDLYKSLLSSKIDGGW 113  Helicobacter pylori
Q48253  123 DWGNAARHYWVKDGQWNKLEVDMQNAVGTYNLSGLINFTGGDLDVNMQKATLRLGQFNGNSFTSFKDGANRTTRVNFDAK 202  Helicobacter pylori
Q48245  114 DWGNAATHYWIKGGQWNKLEVDMKDAVGTYKLSGLRNFTGGDLDVNMQKATLRLGQFNGNSFTSYKDSADRTTRVDFNAK 193  Helicobacter pylori
Q48253  203 NILIDNFVEINNRVGSGAGRKASSTVLTLKSSEKITSRENAEISLYDGATLNLVSssNqSVDLYGKVWMGRLQYVGAYLA 282  Helicobacter pylori
Q48245  194 NILIDNFLEINNRVGSGAGRKASSTVLTLQASEGITSSKNAEISLYDGATLNLAS--N-SVKLNGNVWMGRLQYVGAYLA 270  Helicobacter pylori
Q48253  283 PSYSTIDTSKVQGEMNFRHLAVGDQNAAQAGIIANKKTNIGTLDLWQSAGLSIITPPEGGYESKTKDNP----------- 351  Helicobacter pylori
Q48245  271 PSYSTINTSKVTGEVNFNHLTVGDHNAAQAGIIASNKTHIGTLDLWQSAGLNIIAPPEGGYKDKPNNTPsqsgakndkqe 350  Helicobacter pylori
Q48253  352 --QN-------NPKNDAQKTEIQPTQVIDGPFAGGKDTVVNIFHLNTKADGTLRAGGFKASLSTNAAHLHIGEGGVNLSN 422  Helicobacter pylori
Q48245  351 ssQNnsntqviNPPNSTQKTEVQPTQVIDGPFAGGKDTVVNIDRINTKADGTIKVGGFKASLTTNAAHLNIGKGGVNLSN 430  Helicobacter pylori
Q48253  423 QASGRTLLVENLTGNITVEGTLRVNNQVGGAAIAGSSANFEFKAGEDTNNATATFNNDIHLGKAVNLRVDAHTANFNGnI 502  Helicobacter pylori
Q48245  431 QASGRTLLVENLTGNITVDGPLRVNNQVGGYALAGSSANFEFKAGVDTKNGTATFNNDISLGRFVNLKVDAHTANFKG-I 509  Helicobacter pylori
Q48253  503 YLGkstnlrvNGhtahfknidatksdnGLNtsTLDFSGVTDKVNINKLTTAATNVNIKNFDIKELVVTTRVQSFGQYTIF 582  Helicobacter pylori
Q48245  510 DTG-------NG---------------GFN--TLDFSGVTNKVNINKLITASTNVAVKNFNINELIVKTNGVSVGEYTHF 565  Helicobacter pylori
Q48253  583 GENIGDKSRIGVVSLQTGYSPAYSGGVTFKGGKKLVIDEIYHAPWNYFDARNVTDVEINKRILFGAPGNIAGKTGLMFNN 662  Helicobacter pylori
Q48245  566 SEDIGSQSRINTVRLETGTRSIFSGGVKFKSGEKLVIDEFYYSPWNYFDARNIKNVEITRKFASSTPENPWGTSKLMFNN 645  Helicobacter pylori
Q48253  663 LTLNSNASMDYGKDLDLTIQGHFTNNQGTMNLFVQDGRVATLNAGHQASMIFNNLVDSTTGFYKPLIKINNAQNLTKNKE 742  Helicobacter pylori
Q48245  646 LTLGQNAVMDYSQFSNLTIQGDFINNQGTINYLVRGGKVATLNVGNAAAMMFNNDIDSATGFYKPLIKINSAQDLIKNTE 725  Helicobacter pylori
Q48253  743 HVLVKARNIDYNLVGVqGASydniSASNTNLQEQFKERLALYNNNNRMDTCVVRkdNLNDIKACGMAIGNQSMVNNPENY 822  Helicobacter pylori
Q48245  726 HVLLKAKIIGYGNVST-GTN----GISNVNLEEQFKERLALYNNNNRMDTCVVR--NTDDIKACGMAIGNQSMVNNPDNY 798  Helicobacter pylori
Q48253  823 KYLEGKAWKNTGINKTANNTTIAVN-LGnNSTPTNSTTDTTNLPTNTTNNARFASYALIKNAPFAHSATPNLVAINQHDF 901  Helicobacter pylori
Q48245  799 KYLIGKAWKNIGISKTANGSKISVYyLG-NSTPTENGGNTTNLPTNTTNNARFASYALIKNAPFAHSATPNLVAINQHDF 877  Helicobacter pylori
Q48253  902 GTIESVFELANRSSDIDTLYANSGAQGRDLLQTLLIDSHDAGYARTMIDATSANEITQQLNAATTTLNNIASLEHKTSGL 981  Helicobacter pylori
Q48245  878 GTIESVFELANRSKDIDTLYANSGAQGRDLLQTLLIDSHDAGYARTMIDATSANEITKQLNTATTTLNNIASLEHKTSSL 957  Helicobacter pylori
Q48253  982 QTLSLSNAMILNSRLVNLSRKHTNHIDSFAKRLQALKDQRFA 1023 Helicobacter pylori
Q48245  958 QTLSLSNAMILNSRLVNLSRRHTNNIDSFAKRLQALKDQRFA 999  Helicobacter pylori
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap