1Q18


Conserved Protein Domain Family
Glucokinase

?
pfam02685: Glucokinase 
Glucokinase
This is a family of glucokinases or glucose kinases EC:2.7.1.2. These enzymes phosphorylate glucose using ATP as a donor to give glucose-6-phosphate and ADP.
Statistics
?
PSSM-Id: 397005
Aligned: 37 rows
Threshold Bit Score: 278.291
Threshold Setting Gi: 81404852
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1Q18_A  17 LVGDVGGTNARLALCDIASGE------ISQAKTYSGLDYPSLEAVIRVYLEe----HKVE---------------VKD-- 69 
Q82U19   6 LSGDIGGTKTLLRSAVVRGEEv----eFHHEHLYDSHQYDDFDAILADFL------ERSGc-------------qPVA-- 60  Nitrosomonas europaea
Q5NFE2   4 LSGDIGGTNTRLEVSLLENGAt----qSIAIRKYKGANFNCLSDIIDKFLSev-dlVGQId------------------- 59  Francisella tularensi...
Q8DIT6   7 LGADVGGTKTLVELWEVGGRDw----qLLYRAKYPSRDFPNLTALLQMFLKe----------------------sPAHpq 60  Synechococcus elongatus
P58616   5 LAGDIGGTKTILRLVEISNSSel---hNIYEESYQSGDFPDLVPMVQQFLVka--------------------niPSHpe 61  Nostoc sp. PCC 7120 =...
Q31RR6   5 LAGDIGGTKTNLMLAIASDCDrl---ePLHQASFASAAYPDLVPMVQEFLAaa--pSAEVr-------------sPVV-- 64  Synechococcus elongat...
Q6APD5   3 LAGDIGGTKTNLALYTCSCPAgngsliDSSAKTYLNADFASGEELVCGYLAg---iDTTIk------------------- 60  Desulfotalea psychrop...
Q60BB6   3 LAGDVGATKTVLGLFDCWGDRl----vSLSEAIFASTDYASLETVVAAFLD-----GQEEr-------------rPEV-- 58  Methylococcus capsulatus
Q7VBM7   4 LAADIGGTKTLLGVFRYEGQIk-----QLYKAKYSSEDWDNFDLMLKDFIAn---lPSNIt-------------tPKY-- 60  Prochlorococcus marinus
Q72D94   8 LAADIGGTRSRFAYFDYAGGEl----gMGDVVRIPTAEATGFDDLLGRVRAaapgaWARLtrqtdtgndapdtpdASVta 83  Desulfovibrio vulgari...
1Q18_A  70 -GCIAIACPITGDWVAX-TNHTWAFSIAEXKKNLGFS--HLEIINDFTAVSXAIPX-LKKEHLIQFGGAEPV-----EGK 139
Q82U19  61 -ACLAVAGPIVEQQVHL-TNLPWMISAAGIAEKFSIP--AVKIINDFEGTAASIEI-LPQDDLITLQAGKPS-----SSA 130 Nitrosomonas europaea
Q5NFE2  60 sVCLAVAGFVSNGEVEV-TNLPWMVSEQYISEGLGIDktKVKVINDFEAIGYGIESlDREKDIITIQEGKKD-----DDN 133 Francisella tularensi...
Q8DIT6  61 rACLGIPGPVIDQVAQV-TNLGWRVSAAELETALQIP--GVTLLNDFAAVAYGALV-LPPTDFVVLQERPRR-----PQA 131 Synechococcus elongatus
P58616  62 kACFAIAGPVVNNTAKL-TNLVWFLDTERLAQELSIP--FISLINDFAAVGYGIFG-LNKQDLLTLQAGKHQ-----PEA 132 Nostoc sp. PCC 7120 =...
Q31RR6  65 -ACFGIAGPVVHGTAKL-TNLPWQLSEARLAKELGIA--QVALINDFAAIAYGLPG-LTAEDQVVVQVGEAD-----PAA 134 Synechococcus elongat...
Q6APD5  61 rAVFAVAGPIRDGQVKI-TNLPWLISVEQLSVATGIA--TIHLMNDLEATAYAVPF-LSRDELYTLNQGISV-----ERG 131 Desulfotalea psychrop...
Q60BB6  59 -ACFGVPGPVSEGRCEI-TNLPWVLSERELAAATGVS--AVRLLNDVQAMALGMAYrLGEDDWVELNPGAGRp----RSG 130 Methylococcus capsulatus
Q7VBM7  61 -ACIGVAGAINNKIVKL-TNLNWQISQESLCKTLNTD--EVILLNDFSCLVYAIPY-LQQKQYKYIQSLKTNldyqkEGS 135 Prochlorococcus marinus
Q72D94  84 fAAFAVAGPVEEGARCLpPNIGWHID---LATTRGLPc-AASLLNDFEAQGWACLL-PGAQQCLQLLPGKPD-----ATA 153 Desulfovibrio vulgari...
1Q18_A 140 PIAVYGAGTGLGVAHLVHVDKRWV-SLPGEGGHVDFAPNSEEEAIILEILRAEI--GHVSAERVLSGPGLVNLYRAIVKA 216
Q82U19 131 MRVVLGAGTGMGVAWLAWRGQYYE-PLATEAGHIDFAPTSAIQIELLRYLMVRY--HRVSIERLLSGQGLTHIFNFLQTR 207 Nitrosomonas europaea
Q5NFE2 134 LCAVVGAGTGLGMCLVSYDKDDKPrVYKTEGGHVDFSPVDDEQVELFKFMRKTF--HRISPERFCSGYGIYNIYKYVVRH 211 Francisella tularensi...
Q8DIT6 132 PIALLGAGTGLGEALLIWQGDRYQ-VMPLEGGHTDFPPRNEEEVGLLRYLWQTY--ERVSVERVVSGPGLVAIYDYLKSV 208 Synechococcus elongatus
P58616 133 PIAIIGAGTGLGQGFLIKQGNQYQ-VFPSEGGHADFAPRNELEFQLLKYLLDKHdiQRVSVERVVSGQGIVAIYQFLRDR 211 Nostoc sp. PCC 7120 =...
Q31RR6 135 PIAILGAGTGLGEGFIIPTAQGRQ-VFGSEGSHADFAPQTELESELLHFLRNFYaiEHISVERVVSGQGIAAIYAFLRDR 213 Synechococcus elongat...
Q6APD5 132 NIALIAPGTGLGESFLTWEGTRYS-AHATEGSHVDFAPTNALQIKLLDYLLRGY--EHVSYERICSGIGIPNIYGFLKHS 208 Desulfotalea psychrop...
Q60BB6 131 NVAVIAAGTGLGEAILYWDGERYH-ALPTEGGHSDFAPNGPLEEGLLAFLRDRFc-GHVSYERILSGSGLANLYDYLRHA 208 Methylococcus capsulatus
Q7VBM7 136 IFAILGAGTGLGMARGIITKSGLK-AIPSEGGHREFSPRNNKEWELCQWLKKDLklTRLSIERVVSGTGLANIARWRLSQ 214 Prochlorococcus marinus
Q72D94 154 PVAVVGAGTGLGKCLLLPGTPHR--VLPSEGGHATFAFEGRAEAEYAAFAADRLgvGRLIGDDVLSGPGLSLLYAYHHGE 231 Desulfovibrio vulgari...
1Q18_A 217 D------NRLPEN-----------------LKPKDITERALa--DSCTDCRRALSLFCVIXGRFGGNLALNLGTFGGVFI 271
Q82U19 208 Ate--gtHLKSIEln--------------vDDGATVTRLAFe--HHYPIALQALDLFVEIYGTYAGNLALAGLCRGGVYI 269 Nitrosomonas europaea
Q5NFE2 212 PlydqpeCMELRRalfs---------vsdsDKAAVIVKYAIe--HREPSALRTIDIFLSIYGSVAGNLALTSLPFRGLYI 280 Francisella tularensi...
Q8DIT6 209 HfaaesaGVAAAMar-------------geDPAAVVSQYGL---AGDPLCAEALRMFVEAYGAEAGNLALKSLPLGGVLI 272 Synechococcus elongatus
P58616 212 KlatespEIAQVVrtweqqa---gqaektvDPGAAIGKAAVq--GSDRLSEQALQLFIDAYGAEAGNLALKLLPYGGLYI 286 Nostoc sp. PCC 7120 =...
Q31RR6 214 Hp----dQ--ENPalgaiasawqtggdqapDLAAAVSQAALs--DRDPLALQAMQIFVSAYGAEAGNLALKLLSYGGVYV 285 Synechococcus elongat...
Q6APD5 209 QnieepeWLREQLsq-------------ekDHTAVIVNAALdaqRPCPICRMTVEIFLSVLGAEAGNIALKVMAAGGVYV 275 Desulfotalea psychrop...
Q60BB6 209 GvapeseALHAALas-------------apDRAPIIAEWALe--RRDALCTAVLDLFAAIYGAEAGNLALKSLALGGVIL 273 Methylococcus capsulatus
Q7VBM7 215 Edtk-shPILSIIeannsh------nfnnkLLPERVSIAAk---GGDPIMREVLEMWLSAYGSAAGDLALQELSTEGLWI 284 Prochlorococcus marinus
Q72D94 232 T-----------------------------LPPHEVAARLT-------GSDVVVEWFARFYGRTCRDWALHTLARGGVRI 275 Desulfovibrio vulgari...
1Q18_A 272 AGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVYLIVHDNPGLLGSGAHLRQ 326
Q82U19 270 AGGIAPRIIRILQQSGFIEAFCNKGRYSALVRDIPVYVVMNPKAGLLGAGLLAQR 324 Nitrosomonas europaea
Q5NFE2 281 AGGIAPRLIKQIKESKFLEKFRDKGRMSNMMKDFPVHIIMNTDVGLIGARTYAAG 335 Francisella tularensis subsp. tularensis
Q8DIT6 273 AGGIAPKILAKMADGTFLQGFVNKGRFRPLMEQLYVAVIINPEVGLRGAVHLAAQ 327 Synechococcus elongatus
P58616 287 AGGIAPKILPLIENSNFLLNFSQKGRMRPLLAEIPVHIILNQQVGLIGAALCAAR 341 Nostoc sp. PCC 7120 = FACHB-418
Q31RR6 286 AGGIAGKILPLLTDGTFLQAFQAKGRVKGLLTRMPITIVTNHEVGLIGAGLRAAa 340 Synechococcus elongatus PCC 7942
Q6APD5 276 GGGIVPRILSLLGNGLFMETFNSKGRMSELLVDVPVHIILNPKVAVFGAARYGME 330 Desulfotalea psychrophila
Q60BB6 274 GGGIAPKILPVLQAGRFMAAFTAKGRLSPLLGRLPVRVAIHPQPALLGAAHAASA 328 Methylococcus capsulatus
Q7VBM7 285 GGGTAIKHLDGLSSEIFLNSLKNKGRFSEYLEKLPIMVLIDPEAGLFGAACKAHL 339 Prochlorococcus marinus
Q72D94 276 AGGVAAANPMLVQHGAFAEAFFDCPTHTHLLRTIPVSLVTNADAGLWGAAIFALL 330 Desulfovibrio vulgaris str. Hildenborough
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap