3BPD,2RAQ


Conserved Protein Domain Family
DUF211

?
pfam02680: DUF211 
Click on image for an interactive view with Cn3D
Uncharacterized ArCR, COG1888
Statistics
?
PSSM-Id: 397001
Aligned: 48 rows
Threshold Bit Score: 62.5401
Threshold Setting Gi: 350275831
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3BPD_A              5 GLRRLVLDVLKP-HEPKTIVFALKLSELENVDGVNIHLSEIDQATENIKITILGNNLDYEQIKGVIEDXGGVIHSVDEVV 83  Archaeoglo...
WP_015231915        4 PLRRLVLNITKPiKGPSIIDVAKSIASLSGIDGVNVTVKELDVETATLNITIEGEDISFDKVENVLESLECVIQSIDQVI 83  Caldisphae...
Q9YE91              4 PLRKVVLDVLKPiRGPSIIDVSREVAALPGIEGVNITVKEIDVETVTLTMTIEGSDIDYGSVEKKLEELGCIVHSIDQAV 83  Aeropyrum ...
WP_052846969        2 PIRRLVLDVLKPiRGTSIVDLAEKISSIEGVDGVNISVTDMDVETMGLMIVIEGSNLNFEEIKKLLEEEGCAIHSIDEVA 81  Sulfurisph...
RogerUC:Ahos_1156   2 SIRRIVLDVLKPiKGTTIIDLAGKLTELEGIDGVNISVTDMDVETMGLMVVIEGPNINFEEVKKVLEEDGCAIHSIDEVA 81  Acidianus ...
WP_012021864        2 TIRRIVLDVLKPiRGSSIVDLAERLDNLEGVDGVNISVSDMDVETMGLMVVVEGEDVDFKEVQNILEEEGCAIHSIDEVA 81  Metallosph...
ACR70644            2 NIRRLTFDVDKAmSQPTILEIAQAIHGCPGVSAFNITVSNIDIETVGMDITIVGDYLDHDRLVEAMENTGAAVHSVDQIV 81  Edwardsiel...
EQB69800            2 NIRRLILDVGKGiNRPTLMELSEIISSVKGVEGVNIIVTDMDIETMGVNITIEGNNINYEQVLKGIEEVGAVVHSIDEIA 81  Thermoplas...
EQB67266            5 NIRRVILDVGKGlNRPTLVDLSEAIISVKGVDAVNISVTEIDMETMGTNITVEGTNINFDDLVRTIEDAGAVVHSVDEIA 84  Thermoplas...
Q9HIZ3              6 NIRRVVLDVDKGlNRPTLVELAAAIEKVQGVEAVNIIVTEMDMETMGTNITVEGTNINYDELIETIENTGSAIHSVDEIA 85  Thermoplas...
3BPD_A             84 AGKIIVESV 92  Archaeoglobus fulgidus DSM 4304
WP_015231915       84 TGKKVVDKl 92  Caldisphaera lagunensis
Q9YE91             84 AGKKIVEQE 92  Aeropyrum pernix
WP_052846969       82 SGNKIVEGR 90  Sulfurisphaera
RogerUC:Ahos_1156  82 AGNRLVEGR 90  Acidianus hospitalis W1
WP_012021864       82 SGKRLVEGR 90  Metallosphaera sedula
ACR70644           82 CGSDIVERI 90  Edwardsiella ictaluri 93-146
EQB69800           82 VGSKLIENI 90  Thermoplasmatales archaeon Gpl
EQB67266           85 AGSRLIENV 93  Thermoplasmatales archaeon E-plasma
Q9HIZ3             86 VGKRLIENV 94  Thermoplasma acidophilum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap