6H1H,1TQ5


Conserved Protein Domain Family
Pirin

?
pfam02678: Pirin 
Click on image for an interactive view with Cn3D
Pirin
This family consists of Pirin proteins from both eukaryotes and prokaryotes. The function of Pirin is unknown but the gene coding for this protein is known to be expressed in all tissues in the human body although it is expressed most strongly in the liver and heart. Pirin is known to be a nuclear protein, exclusively localized within the nucleoplasma and predominantly concentrated within dot-like subnuclear structures. A tomato homolog of human Pirin has been found to be induced during programmed cell death. Human Pirin interacts with Bcl-3 and NFI and hence is probably involved in the regulation of DNA transcription and replication. It appears to be an Fe(II)-containing member of the Cupin superfamily.
Statistics
?
PSSM-Id: 396999
Aligned: 37 rows
Threshold Bit Score: 113.5
Threshold Setting Gi: 81797858
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6H1H_A  24 GARVRRSIGR----PELKNLDPFLLFDEFKgg----------------rpGGFPDHPHRGFETVSYLLEGgSMAHEDFCG 83  human
Q9XBR7   3 VKRPYKNLGFad-hGWLQARHHFSFARYFDpdrinwgavrvwnddriapdTGFGMHPHKDMEIVTYIREG-ALTHEDSLG 80  Zymomonas mobilis sub...
P58113   3 DRKPFDKLGGad-hGWLKAKHHFSFASYYDpnnmnwgalrvwnddeiapnTGFPPHPHSDMEIITYVRDG-AITHQDNLG 80  Caulobacter vibrioide...
Q9I4C8   3 ERRPFDRLGHan-hGWLNARHHFSFADYYDperedwgrlrvwnddeiaagSGFPPHPHRDMEIITYVREG-AITHQDSLG 80  Pseudomonas aeruginos...
Q8XXA8   3 EIRPSQERGYad-hGWLQSYHSFSFAEYMDpdhvhfgplrvinedrvapgMGFGTHGHRDMEIISYVLDG-ELAHKDSLG 80  Ralstonia solanacearum
Q8YXP0   9 LIHDRNARGRsq-tGWLDSYHTFSFSSFYDpnrmgfrslrvinddriapgAGFPTHGHRDMEILTYVLSG-AVEHKDSLG 86  Nostoc sp. PCC 7120
1TQ5_A   3 YLRKANERGHan-hGWLDSWHTFSFANYYDpnfxgfsalrvinddvieagQGFGTHPHKDXEILTYVLEG-TVEHQDSXG 80  Escherichia coli
P73623   3 TLRPSEARGHgk-lDWLDSYFSFSFSHYYDpahmnfsnlrvinedyiapgQGFATHGHKDMEIVTYVLEG-ELEHKDSIG 80  Synechocystis sp. PCC...
Q9RDP9   3 VHRADERYPGgdpaAGITSRHAFSFGPHYDpdnlrfgallacneerlapgAGFDEHPHSHTEIVTWVVEG-ELTHRDSTG 81  Streptomyces coelicolor
P9WI85   8 rraaDRAVTTt---SWLKSRHSFSFGDHYDpdnthhglllvnnddqmepaSGFDPHPHRDMEIVTWVLRG-ALRHQDSAG 83  Mycobacterium tubercu...
6H1H_A  84 HTGKMNPGDLQWMTAGRGILHAEMPCSE-EPAHGLQLWV 121 human
Q9XBR7  81 NKGRIEAGDVQVMSAGTGIVHSEYNREA-SDTRLFQIWI 118 Zymomonas mobilis subsp. mobilis ZM4 = ATCC 31821
P58113  81 NKGRTVAGDVQVMSAGSGIRHAEYNLEP-ETTRIFQIWI 118 Caulobacter vibrioides CB15
Q9I4C8  81 NKGRTEAGDVQVMSAGTGIVHSEYNLEA-ETTRIFQIWI 118 Pseudomonas aeruginosa PAO1
Q8XXA8  81 NGSVLRPGDVQRMTAGTGVRHSEFNHAPdQTTHFLQIWV 119 Ralstonia solanacearum
Q8YXP0  87 TGSVIRPGDVQIMSAGKGIQHSEFNHSRtEPLHLLQIWI 125 Nostoc sp. PCC 7120
1TQ5_A  81 NKEQVPAGEFQIXSAGTGIRHSEYNPSStERLHLYQIWI 119 Escherichia coli
P73623  81 NGSIIRPGDVQRMSAGTGILHSEFNPSPdQPVHLLQIWI 119 Synechocystis sp. PCC 6803 substr. Kazusa
Q9RDP9  82 HETVVRAGDVQRLSAAGGVRHVERNDAA-VPLTFVQMWL 119 Streptomyces coelicolor
P9WI85  84 NSGVIYPGLAQRMSAGTGILHSEMNDSAtEPVHFVQMWV 122 Mycobacterium tuberculosis H37Rv
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap