Conserved Protein Domain Family
FlpD

?
pfam02662: FlpD 
Methyl-viologen-reducing hydrogenase, delta subunit
This family consist of methyl-viologen-reducing hydrogenase, delta subunit / heterodisulphide reductase. No specific functions have been assigned to this subunit. The aligned region corresponds to almost the entire delta chain sequence and contains 4 conserved cysteine residues. However, in two Archaeoglobus sequences this region corresponds to only the C-terminus of these proteins.
Statistics
?
PSSM-Id: 396985
Aligned: 224 rows
Threshold Bit Score: 82.5446
Threshold Setting Gi: 503816779
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_013908989     603 LMAFICENDALPALDMAA------LQRKSIPV-TFRIIPVRCLGAVNVSFVKDAMSKGYDGILLLGCKYGEnyqCHFIKG 675 Thermodesul...
KHU:HacjB3_14960 391 IVAFVCGERADDALSEYGkra-asGGRIEYPP--ILPVGVNCADTVGESHITHALACGAAGVAVLGCG-CD---CRH-SG 462 Halalkalico...
Q5V2I9           393 VIAFVCSEYAMDRLRAHGrka-vqSGDLDYPP--ILPVSVNCTDTVGKAHVMHALAAGADGVAVVGCG-GS---CLH-SG 464 Haloarcula ...
WP_014050773     396 VLAFVCSEQAEDALTAYGrqa-grGEEAGYDP--ILPVRVNCTDTVGESQVLHALAAGADGVAIVGCG-DA---CLH-SG 467 halophilic ...
WP_049939735     397 IVAFVCSERAEAALSEYGrraaagTDDIEYPP--ILPVDVNCTDTVGEAHVLHALAAGADGVAIVGCG-GH---CLH-SG 469 Natronomona...
WP_013881230     395 VVAFVCSERAADALAEYGrlaasgRADVEYPP--ILPVQVNCTDTVGEAHVMHALAAGADGVAIVGCG-GD---CLH-SG 467 Halopiger x...
jgi:Htur_2353    395 IVAFVCSEEADDALAEYGrlaaagKAAVEYPP--ILPVRVNCTDTVGEAHAMHALACGADGVAVVGCG-GD---CLH-SG 467 Haloterrige...
CCK79297         190 AIIFACNWSYYPELQASI------LPESEIKDkEYEILVNMCGGRLEAHMLMAPFLQNAWGVMAACCTDNE---CRH-DG 259 Desulfobacu...
jgi:Despr_1352    12 ILLFLCNWGAHAAFLTLQ------DQRRPIPD-EIRMVRTPCTGRIDRAMMLKAFAKGADGVALVGCEPGT---CRYGSG 81  Desulfobulb...
jgi:Sfum_0013     19 IVLFVCNWGPHAALQTLQ------DQDRDIPH-QVRMIRIPCTGRISKTLLFKAFERGADGVALIGCTPGT---CRYGAG 88  Syntrophoba...
WP_013908989     676 SELANRRMENVAETLQQLALEPERVTLYTVAIDEVEEVIKKMNEFNEEIKGF 727 Thermodesulfobacterium geofontis
KHU:HacjB3_14960 463 PDPKEELVERLNQATADLGLG-ERVGFFAPEAGEPGEFVDSLSEFEESLsps 513 Halalkalicoccus jeotgali B3
Q5V2I9           465 PDPKQELVDRLNQATTDLGLG-DRVGFFAPEAGNPEAFVGSLSGFVEfglde 515 Haloarcula marismortui
WP_014050773     468 PDPKQELVERINVATSDLDLG-SRTAFFAPEGDAPRSFAAELDAFVSSLEpt 518 halophilic archaeon DL31
WP_049939735     470 PDPKAELVDRLNTATTDLGLG-ERVAFFSPDPDDPGAFVEALSQFAvvglde 520 Natronomonas pharaonis
WP_013881230     468 PDPKADLVRRLDVATDDLGLG-KRVEFFAPDPNEPEAFVEDVSTFVVGLEes 518 Halopiger xanaduensis
jgi:Htur_2353    468 PDPKADLVERLNRASSDLELG-DRFAFFAPDPDEPGAFVEAISTFAVELEps 518 Haloterrigena turkmenica DSM 5511
CCK79297         260 NLRAKKTVESLRNTFKSIDINPERIQLVQIPPGDKALFQAQIDTFVSDLNKM 311 Desulfobacula toluolica Tol2
jgi:Despr_1352    82 TATSQRNTQDVQKVLDIMGLGGDRLRFAAFLPEESEQLLAFLQEFSSDIRAL 133 Desulfobulbus propionicus DSM 2032
jgi:Sfum_0013     89 TYTAERNVEGARGILDLLGLGKDRLRLATFLPEEASPLLDFLNDFTDQVRGM 140 Syntrophobacter fumaroxidans MPOB
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap