3EQX,3CUC


Conserved Protein Domain Family
Fic

?
pfam02661: Fic 
Click on image for an interactive view with Cn3D
Fic/DOC family
This family consists of the Fic (filamentation induced by cAMP) protein and doc (death on curing). The Fic protein is involved in cell division and is suggested to be involved in the synthesis of PAB or folate, indicating that the Fic protein and cAMP are involved in a regulatory mechanism of cell division via folate metabolism. This family contains a central conserved motif HPFXXGNG in most members. The exact molecular function of these proteins is uncertain. P1 lysogens of Escherichia coli carry the prophage as a stable low copy number plasmid. The frequency with which viable cells cured of prophage are produced is about 10(-5) per cell per generation. A significant part of this remarkable stability can be attributed to a plasmid-encoded mechanism that causes death of cells that have lost P1. In other words, the lysogenic cells appear to be addicted to the presence of the prophage. The plasmid withdrawal response depends on a gene named doc (death on curing) that is represented by this family. Doc induces a reversible growth arrest of E. coli cells by targetting the protein synthesis machinery. Doc hosts the C-terminal domain of its antitoxin partner Phd (prevents host death) through fold complementation, a domain that is intrinsically disordered in solution but that folds into an alpha-helix on binding to Doc.This domain forms complexes with Phd antitoxins containing pfam02604.
Statistics
?
PSSM-Id: 396984
Aligned: 212 rows
Threshold Bit Score: 37.4365
Threshold Setting Gi: 81741542
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3EQX_A       118 PLCvttALEICStIKSvQXd------------vRK--VpgtsltnqaTgEVIYTPPAGES-VIRDLLSNWEAFLHn--QD 180 Shewanella onei...
WP_007102703   6 WLD---RDLVDE-LHD-QSlqvhg----glcgiRD--V-----------NVLEAAIASPR-NLFAY----GGEDN----- 53  Synechococcus s...
WP_004769969   3 LIS---STFVIA-VHD-EIllqtgv------grtgchI-----------EKLESVLSRID-QQMYY----SNVSD----- 50  Acinetobacter
Q9KMA2         5 CFP---FERVIE-INA-FIlktep----gmkgaVD--I-----------PKLQGALGRID-NAIVY----EGLDD----- 52  Vibrio cholerae
Q4WC03         8 FLS---VNQVQR-LHG-LWisp---------taQPvqL-----------PLLESAINSPM-NLKHY----GNQGD----- 52  Aspergillus fum...
EDN10247      12 FLT---AEQVIR-LYK-TSian--------vgpTQ--S-----------AMLESAVASPM-NVKHY----AQQEN----- 55  Histoplasma cap...
ABR13506      18 YLT---VDALVW-INQ-QLilsqtp--aemvgvLK--P-----------NELESSQQRPA-QYRCY----AQNQD----- 67  Pseudomonas aer...
Q3ARL6       202 PLS---VSKIED-IHT-ILtkels----vernlKKrrV---------GiSGTNYCPLDNEfQIAEALRSSCDVIN----A 259 Chlorobium chlo...
Q64WF7        98 IID---ERTLFR-LHQ-SIstglvsn-eesgflRTraV---------RiSGTDYAPPKDLqEIKNKLGEILYEQD----V 158 Bacteroides fra...
WP_012316163 208 GLN---SAVIRN-LHG-LLmqdlladsnalgsiRQtvV---------NiSGTTYFPT----QVPSLLEEMFELILdkaRQ 269 Pseudomonas putida
3EQX_A       181 DVDPLIKXAXAHYQFEAIHPFIDGNGRTGRVLNILYL 217 Shewanella oneidensis
WP_007102703  54 ---LFCLAAHLLVSLAKAHPYSDGNKRIAIISAVAFL 87  Synechococcus sp. RS9917
WP_004769969  51 ---IFEIAAWFGIAISKGHAFVDGNKRTGLAVMLTYL 84  Acinetobacter
Q9KMA2        53 ---VFEIAAKYTACIAVSHALPDANKRTGLAVALEYL 86  Vibrio cholerae
Q4WC03        53 ---VFQLAANLSEKIMKNHAYQDGNKRTALLAADMFL 86  Aspergillus fumigatus
EDN10247      56 ---IFQLAANLSEKIMKNHAFMDGNKRAALLAADMFL 89  Histoplasma capsulatum NAm1
ABR13506      68 ---MYCLASVLMESLVRNHPFANANKRTAAAAGFIFL 101 Pseudomonas aeruginosa
Q3ARL6       260 KSSVFEKALLALVLISYIQPFMDGNKRTARIVSNAIL 296 Chlorobium chlorochromatii CaD3
Q64WF7       159 YTNPLEKTVFLHCNIARLQPFIDGNKRTSRMIESVVM 195 Bacteroides fragilis
WP_012316163 270 IKNPIEAAFFLWINLAYLQPFEDGNKRTSRLAANIPL 306 Pseudomonas putida
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap