3H0M,3AL0,2D6F


Conserved Protein Domain Family
GatB_Yqey

?
pfam02637: GatB_Yqey 
Click on image for an interactive view with Cn3D
GatB domain
This domain is found in GatB. It is about 140 amino acid residues long. This domain is found at the C-terminus of GatB, which transamidates Glu-tRNA to Gln-tRNA.
Statistics
?
PSSM-Id: 396969
Aligned: 93 rows
Threshold Bit Score: 84.9199
Threshold Setting Gi: 7674429
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3H0M_H 328 DFFEEAVRHFKEPKGIVNWLINDLLGLLRDKGISIEESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVET-GKTPSQI 406 Aquifex aeolicus
Q9HQ32 477 QLFEQQVEAGv-DATLAAQTLESTVTELRRDDVPVGR--LTDAHFRGVLGLVADGDLAQEGVPELLAALAEQpGSDPAVL 553 Halobacterium salinar...
Q8TZ12 492 DEFEEIVEETgvEPKVAAATLVNTIPRLEKDGYPVDN--LTIDHVKEVLRLYAEGAIAKSGIEELLGALAADpDSDPEEL 569 Methanopyrus kandleri...
O28832 471 RVFEEYSEKL--QPTVVARVLYLAPAALRREGVEIER--LEERHYRLVLDMVLRGDIAKEGAEEALKLLCQNpEMSAGQL 546 Archaeoglobus fulgidu...
Q9Y9T6 492 SLLEKYRGTL--EPSYVAGFFVVVLRGLEGEGVEVWK--VDDAILEKILDMVAQGEIAREAAAELVKYLANNpGSTVEEA 567 Aeropyrum pernix K1
Q74MN5 304 LFLNIAKENKeiANELAKWYQVFFETEADIKTVEKLK-----DEFIEAVKLYLNGYLNNQGIRKSIKEGIk--EGSILKA 376 Nanoarchaeum equitans
Q82JL2 353 DPIVATIEAGADAASARKWWMGELARSANESGKALEDLPITPAQVARVAQLVVAGELNDKLARQVIEGVLAG-EGTPDEV 431 Streptomyces avermiti...
P61342 353 DLIVETVEAGASASEARSWWVAYLSQKANESGVELDSLSITPQQVARVAALVKEGKLTNKLARQAVDGVLAG-EGDVDEV 431 Corynebacterium dipht...
O33107 359 ELVAATVKNGASSEQARAWWGNFLVQKANEANITLDELAITPAQVAVVVALVDEGKLSIRLARQVVEGVLAG-EGEPEQV 437 Mycobacterium leprae TN
Q8G769 350 DLIEETVKAGAKAAGARKWWLGELSREANAKGVSLEELPITPADVAEVEKLIASGKLNDKLAKQTVEGVLKG-EGTPDEV 428 Bifidobacterium longu...
3H0M_H 407 VEEKGLKQITDENQIKELVKKIFEKHPKEVERLKQGEEKLIGFFVGQVMRETRGKANPQVVNKVIRELV 475 Aquifex aeolicus
Q9HQ32 554 AEELGLGSAAE-DEVREAVVGVVERN---SDQVAAEGMGAFSALMGECMGALRGKADGDLVSEVLREEI 618 Halobacterium salinarum NRC-1
Q8TZ12 570 AEELGIVMASE-EEIEEVVEEAIRRY---EDKIRERGMAVMGKIMGEVMEVLRGRADGKRVSELVRERI 634 Methanopyrus kandleri AV19
O28832 547 KEKIG-----AAEDIDGFIAKLIEEK---ADLIAERGEGAFKPLMGLVMKEFRGKVDGKVVAEKLKKAL 607 Archaeoglobus fulgidus DSM 4304
Q9Y9T6 568 VEKLGLRRLSR-EEVERIVDEIVGGL---REEILKRGEKAVGLVMGRAMAKLRGRADGRLVSEIVSRKI 632 Aeropyrum pernix K1
Q74MN5 377 VERYKIVYPSDEEILR-----IIKQNGKAIYDYLNGKKQAINALLGSVMKAYHSRVDPKWVLNKIQELI 440 Nanoarchaeum equitans
Q82JL2 432 VEKRGLKVVSDEGALTAAVDEAIAGNPGVADKIRGGKVAAAGALVGAVMKATRGQADAARVKELILEKL 500 Streptomyces avermitilis MA-4680...
P61342 432 VAARGLEVVRDDGAIEKAVDEALAANPDIVEKYKAGNTKVTGAIVGAVMKATRGKADPAQVNKLIAEKL 500 Corynebacterium diphtheriae NCTC...
O33107 438 MVDRDLALVRDDSVMQAAVDEALAADPDVAEKIRGGKVAAAGAIVGAVMKTTRGQADAARVRELVLAIC 506 Mycobacterium leprae TN
Q8G769 429 VKKHDYKIVEDNGAIEAAVDAAFEANPDVVEKLKSGNMKPMGVIIGAVMKATRGQADAKAVTKVVMGKI 497 Bifidobacterium longum NCC2705
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap