2PW9


Conserved Protein Domain Family
FdhD-NarQ

?
pfam02634: FdhD-NarQ 
Click on image for an interactive view with Cn3D
FdhD/NarQ family
A pan-bacterial lineage of proteins. Nitrate assimilation protein, NarQ, and FdhD are required for formate dehydrogenase activity. Structurally, they possess a deaminase fold with a characteristic binding pocket, suggesting that they might bind a nucleotide or related molecule allosterically to regulate the formate dehydrogenase catalytic subunit.
Statistics
?
PSSM-Id: 396966
Aligned: 119 rows
Threshold Bit Score: 181.974
Threshold Setting Gi: 81405144
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2PW9_D         32 AIETPYAIALNDRVIGSSMVLPVDLEEFGAGFLFGQGYIKKAEEIREILVCPQgrI---------SVyadVEn------- 95  Desulfotalea p...
WP_011749130   31 PQECPVAIVIDGMSQAVLMATPHDLRDFALGFALTEGLIASPGDVEGFEEAEVs-AggfparearLW---LRpglaarla 106 Paracoccus den...
Q89XM0         28 AEESAIALTYNGSTHAVMMGTPADLEDFGVGFSLTEGIIGCASEIRSIELISNe-Lgve----vrMW---LDgdraasla 99  Bradyrhizobium...
Q0BQR9         27 PEETPVALTYGRATHAVMMATPADLEDFAVGFSLAEGLIDSVHDIESLEIVEVt-Hgve----lrMD---LTqtrdaafi 98  Granulibacter ...
Q89QJ3         26 PEETPLALTYNGGTYAVMMGTPQNLEDFAVGFSLSEGIVRSVDDIRSLEIVRLd-Dgie----lrMW---LApdqaaris 97  Bradyrhizobium...
Q6NBU3         27 PDETPVAISYNGSSQAVMMATPADLEDFAIGFSLSEGVIGQAAEIDSLEIVPHd-Dgve----lrMW---LAgdvaerlq 98  Rhodopseudomon...
WP_012028620   22 PEETAVALTYNGGTQAVMMATPQDLRDFAIGFSLNEGLIKSRDDIVSLDVVELd-Dgie----lrMW---LPdalaerla 93  Bradyrhizobium...
Q20XQ2         35 AEEVPIGVLYSGIPHAVMMASPADLEDFAIGFSVTEGIIKAASDVREISVQQTcdGve-----inLV---LVperfqdfl 106 Rhodopseudomon...
Q1GWR0         28 AVEAPVSVEVGGIAYAVMMATPADLEDYAVGFALSEGLIGASADIRRTDVQPIegGwa-----lrLW---LTternaaal 99  Sphingopyxis a...
jgi:Caul_1609  28 PREVAVGLSFDGRPHTVLMATPADVEDLARGFTLTEA-VARAEDIIAVEITETd-Lgil----adVK---LRpgaiq-rk 97  Caulobacter sp...
2PW9_D         96 --EEP--RevIITSGCGG-TGK---IPkemLEGEFAPlA-DYCLPFAEIKSFIREALHSSPLGPQTHCVHGCGLWN-NGR 165 Desulfotalea p...
WP_011749130  107 erRRS--M--IGPVGCGLcGVDsieAA---LPQIVPVal-gWSMPPGDVARAMAALTQGQVLRRETPAIHGAAFWDgDHA 178 Paracoccus den...
Q89XM0        100 arRRA--I--SGPVGCGLcGIEsleQA---RRAPSRVespgIAFHARDLLSAMQALSPLQTLNQQTRSVHAAAFWHpRAG 172 Bradyrhizobium...
Q0BQR9         99 arRRH--V--TGATGCGLcGMEsldEA---AKSPPRvs-adLVIDAETIVTAMEALSPVQTLNLRTHAVHAAAFWQpGQG 170 Granulibacter ...
Q89QJ3         98 erRRH--I--AGPTGCGIcGIEsiaEA---VR-PAAVvppgQNFTPEQIMTAMQAIAPLQSINMQTRAVHAAAFWSpAGN 169 Bradyrhizobium...
Q6NBU3         99 qrRRH--I--AGPTGCGLcGVDsiaEA---VR-PVATvgagRSFSPQQIIAAIEALPPLQKLNVETRAVHAAAYFTpEQG 170 Rhodopseudomon...
WP_012028620   94 erRRN--I--AGPTGCGLcGIDslaEA---VR-PAAHvpagRRFAPRDIMAALAAIEPLQKLNHETRAVHAAAFWTpARG 165 Bradyrhizobium...
Q20XQ2        107 srRRTrnL--RGHTSCGLcGVEevaDT---RADTPQApA-GQPFSQAAVRRALAALTNHQELHRLTRAAHAAAWVAiEGD 180 Rhodopseudomon...
Q1GWR0        100 erART--R--VSESSCGLcGIAnieEV---LRPLPPVtA-HIGTDRIAIAAALTALDAHQPLGRATGAVHAAAFCSpAGA 171 Sphingopyxis a...
jgi:Caul_1609  98 arPRT--L--EGRSSCGLcGVQrlaDA---VRPLPRVeg-gAKISHPAVQRAIGALDEVQLLGRLTRATHAAAFADaEGR 169 Caulobacter sp...
2PW9_D        166 LQVYHEDVGRHNAVDKVLGSILL-GRASNNSAVYTTGRLTSDMVLKCARIGIPIIMSRTSPSSLGLALAKRSGATLVAYS 244 Desulfotalea p...
WP_011749130  179 I--TREDVGRHNALDKLAGALAQaGLVAGQGAIVMSSRLSVDLVQKAARIGAPILIGASAPTALALEWAERAGITVIARA 256 Paracoccus den...
Q89XM0        173 IAVVREDVGRHNALDKLAGAIVRdGNSARDGAVLLTSRVSVEMVQKAAMIGAPVVVAVSAPTALAIQTANEAGITLLAVA 252 Bradyrhizobium...
Q0BQR9        171 LLAIREDVGRHNALDKLAGFLARsGIPASSGLVLLTSRVSVEMVQKAARMGAGIIVAVSAPTTLAIRTAEAANITLAAVA 250 Granulibacter ...
Q89QJ3        170 IVALREDVGRHNALDKLAGALARsRTDARGGMVLLTSRVSVEMVQKTAAIGAPLMVAVSAPTALAVRTAEAAGITLIAIA 249 Bradyrhizobium...
Q6NBU3        171 IQHVREDVGRHNALDKLVGALARdRIDAANGIVLLTSRVSVEMVQKTAAIGAAVLVAVSAPTALAVRMAEAAGITLAAIA 250 Rhodopseudomon...
WP_012028620  166 IVSLREDVGRHNALDKLAGHLAQtGSAASEGLVMMTSRVSVELVQKAAAMGAPVLVAVSAPTALAIRMAEAAGITLIAVA 245 Bradyrhizobium...
Q20XQ2        181 ILLVREDVGRHNALDKLIGAAMRqGFDLGAGFCLITSRCSYEMVQKALMASMPAIVAISAPTGLAVRTAAAAGLTLVALA 260 Rhodopseudomon...
Q1GWR0        172 IRLVREDVGRHNALDKLIGALARaGIDAGEGFMLLSARCSYELVEKTVRAGCPMLVTISAPTSLAATRAAAAGLTLVALA 251 Sphingopyxis a...
jgi:Caul_1609 170 LVLVREDVGRHNALDKLAGAMARdGGDASEGFVLVTSRCSFEMVEKTVRMGGAILVAVSAPTDLAIRRAEESGLTLVALA 249 Caulobacter sp...
2PW9_D        245 RPERINVFNAPERIL 259 Desulfotalea psychrophila LSv54
WP_011749130  257 RGDGFDLYTHPRRIA 271 Paracoccus denitrificans
Q89XM0        253 RDDGYGVFTHSRRVL 267 Bradyrhizobium japonicum
Q0BQR9        251 RRDGFELFTHPWRIP 265 Granulibacter bethesdensis CGDNIH1
Q89QJ3        250 RQDGFEVFTHGGRIV 264 Bradyrhizobium japonicum
Q6NBU3        251 RSDGFEIFTHPQRIV 265 Rhodopseudomonas palustris
WP_012028620  246 RNDGFEIFTHPHRIV 260 Bradyrhizobium sp. ORS 278
Q20XQ2        261 RDEGQNVYAGAHRID 275 Rhodopseudomonas palustris BisB18
Q1GWR0        252 RPDAALVVADPQGMI 266 Sphingopyxis alaskensis
jgi:Caul_1609 250 RADGHTVFACPERLL 264 Caulobacter sp. K31
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap