1XRH,1X0A,2X06,2G8Y,1S20,3UOE


Conserved Protein Domain Family
Ldh_2

?
pfam02615: Ldh_2 
Click on image for an interactive view with Cn3D
Malate/L-lactate dehydrogenase
This family consists of bacterial and archaeal Malate/L-lactate dehydrogenase. L-lactate dehydrogenase, EC:1.1.1.27, catalyzes the reaction (S)-lactate + NAD(+) <=> pyruvate + NADH. Malate dehydrogenase, EC:1.1.1.37 and EC:1.1.1.82, catalyzes the reactions: (S)-malate + NAD(+) <=> oxaloacetate + NADH, and (S)-malate + NADP(+) <=> oxaloacetate + NADPH respectively.
Statistics
?
PSSM-Id: 396949
Aligned: 350 rows
Threshold Bit Score: 249.669
Threshold Setting Gi: 158330303
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1XRH_G                  8 ETLHQLIENKLCQaGLKREHAATVAEVLVYADARGIHSHGAVRVEYYAERISKGGTNREPEFRLEETGPCSAILHADNAA 87  Escher...
jgi:Cycma_3367         10 EILKTTFANILIQrGFEAKKAKICAELFSMASLDGVASHGLNRFPAFLEQVEGGRVIPEAEPVLEFSLPIMERWDGQLGA 89  Cyclob...
jgi:Echvi_3091          8 SEIQATLKQVLLHhQFTDEKAALSAYLFAKASLDGVPSHGLNRFLDYLRYVDLGWIIPTADPEVVAKFGSFERWNGHSGP 87  Echini...
jgi:AciX8_0342          7 DELRNTLERVLLHlGLEPERAALSARLTAETDRDGVRTHGIARLPRFAEMVRNGSVDPLAQPECIASFGAMERWTGHRGP 86  Granul...
PRJNA194094:J421_0713   6 DTLRDTLATLLTSlGFPADDAAECARVFADASRDGVASHGLDRVPRFVGMVRDGVVDPAARPVTLATHGALERWDGRRGA 85  Gemmat...
WP_013580119            7 ADLEQALTSTLIPlGFTPARAGLCARLFTETTCDGVYTHGLNRFPRFLATIRNGVVNPTAEPTLTSAFGAIERWHGNRGA 86  Granul...
WP_013567135            7 AELQSTISAVLQRtGVSPKRADRCATLFAETTRDGVYTHGLNRLPRMLAMIANGSVSTTAEPTVVASHGALESWDGHLGI 86  Terrig...
tigr:ACP_1954           7 DDLHRAFIAALTHvGFTPERAELCARLFAETTLDGVYSHGANRFPRFLAMIRNGAVDVHATPQCMSAFGALERWDGRRGP 86  Acidob...
jgi:SpiGrapes_1800      6 DEMVGEFERVLVKyGLSKEKAKISARLFAEASLDGVYTHGLNRFPKFITSVKNGSVHITAEPSFEGKFGSFERWNGNKGP 85  Sphaer...
jgi:SpiBuddy_2240       7 ETLVAQFEKVLTSrGMDAEDAKLCSQLIAETSAQGVYTHGANRFPFLVKMIDDKLVDVHVKPEKSASFGSLERWDGKGGM 86  Sphaer...
1XRH_G                 88 GQVAAKXGXEHAIKTAQQNGVAVVGISRXGHSGAISYFVQQAARAGFIGISXCQSDPXVVPFGGAEIYYGTNPLAFAAPG 167 Escher...
jgi:Cycma_3367         90 GMYNASFAMKRAAAMAIKNGMGCVALNNTNHWMRAGNYGWQAAEAGCISICFTNTIPNMPAWGGKEPKLGNNPLVIGLPY 169 Cyclob...
jgi:Echvi_3091         88 GNLNAHAAMDAAISMAKSTGFGVVALQHTNHWMRAGNYGWQAVEAGCIGICFTNTKPNMPGWGGSEPKLGNNPLVVAIPR 167 Echini...
jgi:AciX8_0342         87 GNLAAHAAMARAMELATEHGLGAVALGDTTHWQRGGAFGWQAAEAGLAALCWTNTLPNLPPWGATTPALGNNPLVLAVPR 166 Granul...
PRJNA194094:J421_0713  86 GPLNAGRAMDRAIALARAHGVGCVALGNTNHWMRGGTYGWQAADAGVVGLCWTNTLPNMPPWGSAVPRLGNNPLVVAVPR 165 Gemmat...
WP_013580119           87 GNLNAHASMARAIALARTHGIGCVALAQTNHWMRGGTYGWQAADQGLFAISFTNTLPNLPVWGSSAPTLGNNPLVLAIPR 166 Granul...
WP_013567135           87 GNLNAEAAMARAMELADQYSLGCVALRNTSHWMRGGTYGWQAADRGYFALSWTNTNPNTPAWGTAGPTLGNNPFVVAIPR 166 Terrig...
tigr:ACP_1954          87 GNLNAHAAMERALALSRTHGIGCLALRNTNHWMRGGSYGWQAANAGSIALCWTNTMPNLPAWGTREASVGNNPLIVAVPR 166 Acidob...
jgi:SpiGrapes_1800     86 GNLNALSAMERSIALAKEHVFGCVTLSNTNHWMRPGAYGLLAAKENCIGILWTNTVPNMPPWGAKDAHLGNNPMVVAIPH 165 Sphaer...
jgi:SpiBuddy_2240      87 GNLNAYAAMNRAIALAKEHTIGCVALSHTNHWMRPGTYGLMAAEQDCIGILWTNTMPLMPAWGGIDAKVGNNPLVLCIPC 166 Sphaer...
1XRH_G                168 e---------GdEILTFDXATTVQAWGKVLDARSRNXSIPDTWAVDKNGVPTTDPFAV---HALLPAaGPKGYGLXXXID 235 Escher...
jgi:Cycma_3367        170 k--------nK--AVILDTAMTQYSYGKMAIYKRSGKQLPYAAGFDAEGQLSKNPIEViaeKLPLPIgLWKGAGLSLMLD 239 Cyclob...
jgi:Echvi_3091        168 q--------nG--PIVLDMAMSQFAYGKMAIHAKAGKEMPYDAGFDEAGNLSRSPSAIiekEMALPIgLWKGAGLSLVLD 237 Echini...
jgi:AciX8_0342        167 tp-------aG--TIVLDMAMSQYSYGTLAAYRERGAQLPFDGGFDEHGVLTRDPAAIersQRSLPIgLWKGSGLSFVLD 237 Granul...
PRJNA194094:J421_0713 166 a--------dG--HVVLDMAMSQFSYGALASHRRRGEPLPVPGGFDEAGALTTDPAGIersGRVLPIgYWKGSGLSLVLD 235 Gemmat...
WP_013580119          167 p--------eG-RNIVLDMAMSQYSYGTLTAYAKRGAQLPYPGGFDAQGNMTTDPAAIeqtARALPIgLWKGSGLSLTLD 237 Granul...
WP_013567135          167 inpktgdyrsG-PHVVLDMAISQFSYGQLDAHIARGEQLSVPGGFDPEGNLTRDPAAIresYRALPIgFWKGSGLALTLD 245 Terrig...
tigr:ACP_1954         167 r--------aG--HLVLDMAMSQFSYGALESYSRRSELLPIPGGFDASGTLTNDPAAIeasQRPLPIgYWKGSGLALLLD 236 Acidob...
jgi:SpiGrapes_1800    166 g--------eV--PVLLDVAMSMFSYGKLEMYNRLGKELPIPGGFDSEGNMTTDPGKIletHQVFPIgYWKGSGLSLVLD 235 Sphaer...
jgi:SpiBuddy_2240     167 k--------dG--PVLVDAAMSLFSYGKLETYAREQKSLPVPGGYDQEGNLTTDAKEIlasKRPLPIgFWKGTSLAFALD 236 Sphaer...
1XRH_G                236 VLSGVL-LGLPFG---RQvSSXYddlhagrnlGQLHIVINPNFF-SSSELFRQHLSQTXRELNAITPAPGFNQVYYPGQD 310 Escher...
jgi:Cycma_3367        240 LLASGLsDGQSSQeigR--QQEEyg------vSQFFLCIHPEVMgISKTNLDGKIEHTIADLKQSKVFD-GMDIHFPGEQ 310 Cyclob...
jgi:Echvi_3091        238 MLAMVLsGGDATHevgT--HEGErg------lSQVFLALDPKGFg-LEEWMEERLDKVIQDLKKSGVFQEGDSLRYPGEQ 308 Echini...
jgi:AciX8_0342        238 VLAAMLaGGRSAHqidTD-PLKEvg------qSQVFLAIAPQSMs-SMEELNTIAQGAIEALHAATPIEPGKPARYPGEG 309 Granul...
PRJNA194094:J421_0713 236 LVAALLaGGRATHeipTD-PAREsg------lSQLFLAIDPALG---DGPGSTIVDAVVDDLHHATGAR------YPGER 299 Gemmat...
WP_013580119          238 LIAAMLsGGLATHqieTD-SLKEtg------lSQLFLAIDPTHIt-DPEALAQTATQAIADLQSATPIDPSRPPRYPGEE 309 Granul...
WP_013567135          246 LFAAMLsGGKATHeisLD-PLFEtg------iSQIFLVVSPSNVa-HAEAMTQTVDALIQALRSAPRSDPATPPRYPGEE 317 Terrig...
tigr:ACP_1954         237 AVAAMTaLGNATHqlaRD-PLQEtg------lSQMFIAIHPAALd-AAADANHLADEIVASLHAAAPVDPGRPARYPGEQ 308 Acidob...
jgi:SpiGrapes_1800    236 LICATLsGGKTSYeigK--LPNEte------lSQIFIAINLDAFp-DKNAMEEKIEASLQDLKRSIPQIPGQVVRFPGEG 306 Sphaer...
jgi:SpiBuddy_2240     237 LIVSALsGGNTTRqlgL--MGKEss------vSQLFLAINLSSLp-DRERIEAEIHASLEDLKSSQREHESAAVRFPGEL 307 Sphaer...
1XRH_G                311 QDIKQRKAAVEGIEIVDDIYQYLI 334 Escherichia coli
jgi:Cycma_3367        311 SFIRREENLRLGVPVDADIWGKVC 334 Cyclobacterium marinum DSM 745
jgi:Echvi_3091        309 TLNTRDYNTRNGVPVDEDIWRDIK 332 Echinicola vietnamensis DSM 17526
jgi:AciX8_0342        310 TLATREESLRLGVVVDETQWQRVQ 333 Granulicella mallensis MP5ACTX8
PRJNA194094:J421_0713 300 ALRTREVSLRDGVAVDDEVWTLVr 323 Gemmatirosa kalamazoonesis
WP_013580119          310 TLRLREENLRLGIPVEEEIWNSLA 333 Granulicella tundricola
WP_013567135          318 TLRLREENTRLGIPVDESVWAEIQ 341 Terriglobus saanensis
tigr:ACP_1954         309 TLRLREENLRLGIPVEDVIWQQIL 332 Acidobacterium capsulatum ATCC 51196
jgi:SpiGrapes_1800    307 MVKTREENTRLGIPVDDLVWKGVK 330 Sphaerochaeta pleomorpha str. Grapes
jgi:SpiBuddy_2240     308 RTHIREENLREGIPIDERIWQTIL 331 Sphaerochaeta globosa str. Buddy
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap