Conserved Protein Domain Family
Exonuc_VII_S

?
pfam02609: Exonuc_VII_S 
Exonuclease VII small subunit
This family consist of exonuclease VII, small subunit EC:3.1.11.6 This enzyme catalyzes exonucleolytic cleavage in either 5'->3' or 3'->5' direction to yield 5'-phosphomononucleotides. This exonuclease VII enzyme is composed of one large subunit and 4 small ones.
Statistics
?
PSSM-Id: 396944
Aligned: 743 rows
Threshold Bit Score: 27.3431
Threshold Setting Gi: 123090926
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_013445850      8 YTEAVAELEQILAELEsNSEINMDLIAEKVKRAAVLMEFCKKQLHELDEELEK 60  Paludibacter propionicigenes
BAM04008         15 FEQALTALEGLIERVE-SGETSLEDALRDYAAGTALIQRCRDVLDTAETRMAE 66  Phycisphaera mikurensis NBRC 102666
Q8Y7C3            8 FEEAIAELETIVEALE-NGSASLEDSLDMYQKGIELTKLCQDKLQSAEKRMAK 59  Listeria monocytogenes EGD-e
jgi:Selsp_1070    9 FEQALAELEELVQAME-SGDLSLEQLMENYAKGVELAKFCMTSLDRAEKAMDV 60  Selenomonas sputigena ATCC 35185
Q21UG5           32 FEAAQEELEQLVARLE-SGDLPLDQLLSQYQRGAELLKFCRDRLEAVESQIKV 83  Rhodoferax ferrireducens T118
jgi:Daci_2240    15 YESALQELEQLIAQIE-SGQLPLEQMLTGYQRAAQLLGYCRGQLDAVQEQVKV 66  Delftia acidovorans SPH-1
jgi:CAP2UW1_4103 27 FEAALAELEQIVQSME-EGRLPLEESLAAYQRGSDLLRHCQQQLSDAEQRIQI 78  Candidatus Accumulibacter phosphatis cl...
WP_004310079     11 FEAAVSELEAIVQEME-SGNLPLEDALARYQRGVGLLRHCQTTLSDAEQRVRM 62  Thauera
A1K4R2           11 FEAAVAELETIVQQME-SGQLSLEDALARYQRGVGLLKFCQETLSGAEQRIRQ 62  Azoarcus sp. BH72
BAL23518         11 FESAIAELESIVQAME-TGSITLEQALEHYQRGTNLLKYCQETLQAAEQRVQQ 62  Azoarcus sp. KH32C
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap