1KNX


Conserved Protein Domain Family
Hpr_kinase_N

?
pfam02603: Hpr_kinase_N 
Click on image for an interactive view with Cn3D
HPr Serine kinase N-terminus
This family represents the N-terminal region of Hpr Serine/threonine kinase PtsK. This kinase is the sensor in a multicomponent phospho-relay system in control of carbon catabolic repression in bacteria. This kinase in unusual in that it recognizes the tertiary structure of its target and is a member of a novel family unrelated to any previously described protein phosphorylating enzymes. X-ray analysis of the full-length crystalline enzyme from Staphylococcus xylosus at a resolution of 1.95 A shows the enzyme to consist of two clearly separated domains that are assembled in a hexameric structure resembling a three-bladed propeller. The blades are formed by two N-terminal domains each, and the compact central hub assembles the C-terminal kinase domains.
Statistics
?
PSSM-Id: 396938
Aligned: 324 rows
Threshold Bit Score: 61.6433
Threshold Setting Gi: 502625315
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1KNX_B                    4 LLVKELI-EQFqdCVNLIDghTNTSNV---IRVPGLKRVVFEMLGLFSSQ----IGSVAILGKREFGFLSQkTlVEQQQ- 74  Myco...
WP_022001435              4 ITVEKLLgNNK--NYQQVT--GNEESLkrvILTGEINRPGFELAGFFKHSd---FRRIIVFGDKEMAFIAE-M-TEERQk 74  Erys...
CDE27642                  5 VKLKDLMnNPA---YKRVS--GDEESLereVFVAEINRPGFELAGFFKHSd---FRRIILLGDKENIFIKE-M-TKESQl 74  Cate...
WP_003774444              7 CSVKTLV-DHF--GFKQVA--GDRESLrrrITLPNTNRPGLELTGFYAHAe---PKRVVIIGNKESSFIKT-L-DELEQe 76  Erys...
PRJNA289613:ADH65_18380   7 VKVRTLV-ENF--DFIQIT--GDDASLerpIVIADTNRPGLELAGYFENSq---QKRLVILGDKEIAYIAT-M-SVHKQr 76  [Clo...
CDA34259                  4 VTVKELS-EQF--DWEQVA--GDETSLlrqIELADTNRPGLELAGYFPETm---VKRLVVIGEKESRYIEEeM-DQISQr 74  Firm...
WP_025250616              4 LRIKNLV-DH----FDLEVisGSEHLDn-iIEVYGLNRAGLELAGYVEKDd--qKRRVVLFSNKENNYIST-F-SPEERe 73  Spir...
Q6F255                    4 LTIKELV-NK----FDFEIisGAEHIDs-eITVYGLNRAGLELTGYFNEKedkkHKRAILMSSKENNYMSQ-F-SDEEAy 75  Meso...
blanchard:MPUT9231_6410  10 mNIKDLV-SD----YNFEIisGKNKFDt-qINSYGLNRAGLELTGYFVKAadkkNKRVVLLSSKENSYVTQ-F-DKELKa 81  Myco...
P61325                    4 FTIKDLT-DN----LKFEIisGQDKLDt-eIKSYGINRAGLELADYFKPFkdqsEWRATLMSTKESGYMLQ-F-DEETKi 75  Myco...
1KNX_B                   75 -ILHNLLKLNPPAIILTKSFTDPTVLLQVNQTYQVPILKTDF-FSTELSFTVETYI 128 Mycoplasma pneumoniae
WP_022001435             75 eIFPCLINEEVPCIVICKGHACPEVLKNIADERNFPIFQTEM-ITGVVSSELMNTL 129 Erysipelotrichaceae
CDE27642                 75 aCFSKLVNDETPCIIIAKGYETPEILRNIACKRNFPIFETEM-ATGRVSINLMgkl 129 Catenibacterium sp. CAG:290
WP_003774444             77 eRFGTILNEETPFALITGGNPCPPTLCKVANQKNFPVFVTER-PSSDIMVEIVTFL 131 Erysipelothrix rhusiopathiae
PRJNA289613:ADH65_18380  77 kSFDFITNEQTPAIIVTKGHKCPDVLKRYAKRKNFPIFLSSS-PTYRLIVDIVAFL 131 [Clostridium] innocuum
CDA34259                 75 rSFEFLTNEQTPAIVIAHNQKVPEVLVELAMRKNFPVFHTKE-KTSRTVINITNFL 129 Firmicutes bacterium CAG:536
WP_025250616             74 kKYYSMLKIGIPAVIITERFH-DEFLAKVTKDLEIPLLRVVGqTTSEFTQQVlgly 128 Spiroplasma sabaudiense
Q6F255                   76 eKYKNLIKMGSPVIIVTQKFT-DERLSKIAKEFNFPLLKINYpSTSELTQKILDiy 130 Mesoplasma florum
blanchard:MPUT9231_6410  82 kKYFDLMNSGTPVIIITQKFT-DPVLVEVAKKLDFPLLRTTGeSTTQIIRKILdvf 136 Mycoplasma putrefaciens Mput...
P61325                   76 kKYTQLMKCGIPVLIITNKFK-DKTLIKVAKRLNFPLLRSDYpITIQLVQKIQDiy 130 Mycoplasma mycoides subsp. m...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap