5MAW,3IQC,1ORJ,6CH3


Conserved Protein Domain Family
FliS

?
pfam02561: FliS 
Click on image for an interactive view with Cn3D
Flagellar protein FliS
FliS is coded for by the FliD operon and is transcribed in conjunction with FliD and FliT, however this protein has no known function.
Statistics
?
PSSM-Id: 396902
Aligned: 389 rows
Threshold Bit Score: 57.8837
Threshold Setting Gi: 81662029
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5MAW_E                      7 YTAYQQ----NSVNTATPGELTLMLYNGCLKFIRLAAQAIENDDMERKNENLIKAQNII-QELNFTL--NRNI---ELSA 76  Ba...
Academia_Sinica:M5M_02300   7 AELYRQlgleAQITGASPHRLIGLLYAGAIGELNRAIACESQGQRQARINAIAKCVDIL-NGLLESLsfEVES---DLPY 82  Si...
6CH3_B                      7 IKAYAQvsveSAVMSASPHQLIEMLFDGANSALVRARLFLEQGDVVAKGEALSKAINIIdNGLKAGL--DQEKg-gEIAT 83  Sa...
P26608                      7 TQAYAQigveSAVMSASQQQLVTMLFDGVLSALVRASLFMQDNNQQGKGVSLSKAINIIeNGLRVSL--DEESk-dELTQ 83  Es...
WP_015697542                7 AKAYAQigleSAVMSASPHQLVVMLFDGARSALIRAGIFMQQGDIPGKGNALSKAINIIdNGLIAGL--SREKgdpELVD 84  Ra...
Q6D6F6                      7 SQAYAQvgleSSVMSASPHQLIVMLFDGARSAMVRARILMEQGDIPGKGMALSKAINIInNGLKAGL--DAEGg-gELVE 83  Pe...
WP_025420886                7 tAAYANvglqSSVLNASPHQLIVLLFDGAISALIKAEIYLEQNNMVAKGNAISKAINIIdNGLKMAL--DMEKg-nEISR 83  So...
WP_004236802                7 NQAYQQvnleSEITNASPYQLIRILFNGALSALRRSEIFMEQNDIAAKGKELSKAINIIdNGLKQAL--DYDAg-gELAH 83  Mo...
Q7N5J6                      7 SQLYAQidveSEIMNASPYQLIQILFNGALSALRRAIILMEQGNIAEKGAAISKAINIIdNGLKQGL--DNEKg-gELAH 83  Ph...
WP_004243499                7 SKMYAQidveSEILNASPYQLIQILFNGALSALRRALILMEQGNIAGKGENISKAINIIgNGLKQGL--DKEKg-eELAE 83  Pr...
5MAW_E                     77 SMGAMYDYMYRRLVQANIKNDTGMLAEVEGYVTDFRDAWKQAI 119 Bacillus subtilis
Academia_Sinica:M5M_02300  83 RLESLYVYMIQRLLTVQASFDGETCKEVQGLLEVLADGWQQMT 125 Simiduia agarivorans SA1 = DSM 21679
6CH3_B                     84 NLSELYDYMIRRLLQANLRNDAQAIEEVERLLSNIAEAWKQIS 126 Salmonella enterica subsp. enterica ser...
P26608                     84 NLIALYSYMVRRLLQANLRNDVSAVEEVEALMRNIADAWKESL 126 Escherichia coli K-12
WP_015697542               85 NLEALYSYMVRRLLHANLHNDQEAIAEVLTLLENIADAWRQIg 127 Rahnella aquatilis
Q6D6F6                     84 NLSALYDYMSHRLLIANLHNDAKAIEEVEALLENIADAWRQIg 126 Pectobacterium atrosepticum
WP_025420886               84 NLAALYDYFIRQLMQANLKKDAVAIKHVRALLTDIADSWKQIP 126 Sodalis praecaptivus
WP_004236802               84 NLASLYDYMIMRLLNANIENNVTYVKEVYQLLSDLAATWQQIg 126 Morganella
Q7N5J6                     84 NLASLYDYMTQRLLYANLRNDEPAITEVIKLLTEISDAWRQIg 126 Photorhabdus laumondii subsp. laumondii
WP_004243499               84 NLALLYDYMITQLLDANLKNNPEKIHEVIKLLTEISDAWQQIg 126 Proteus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap