Conserved Protein Domain Family
Arteri_GP4

?
pfam02497: Arteri_GP4 
Arterivirus glycoprotein
This is a family of structural glycoproteins from arterivirus that corresponds to open reading frame 4 (ORF4) of the virus.
Statistics
?
PSSM-Id: 111400
View PSSM: pfam02497
Aligned: 3 rows
Threshold Bit Score: 267.205
Threshold Setting Gi: 81925654
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ADO79962   1 MAAATLFFLAGAQHIMVSEAFACKPCFSTHLSDIETNTTAAAGFMVLQDINCFRpHGVSAAqEKISfgKSSQCREAVGTP 80  Porcine reproductiv...
O55485     1 MASSLLFLVVGFKCLLVSQAFACKPCFSSSLADIKTNTTAAASFAVLQDISCLR-HRDSAS-EAIR--KIPQCRTAIGTP 76  Porcine reproductiv...
Q06500     6 IYPTLVFILVGFECFLFSQALHCRPCYTKAVSVLNHSNIPLGNGLLMHTQGCHM-KRSRGG--------DP-CYTWIGQG 75  Lactate dehydrogena...
ADO79962  81 QYITITANVTDESYLYNADLLMLSACLFYASEMSEKGFKVIFGNVSGVVSACVNFTDYVAHVTQHTQQhHLVIDHIRLLH 160 Porcine reproductiv...
O55485    77 VYVTITANVTDENYLHSSDLLMLSSCLFYASEMSEKGFKVVFGNVSGIVAVCVNFTNYVQHVKEFTQR-SLVVDHVRLLH 155 Porcine reproductiv...
Q06500    76 EGVGINFNYTGAGHDHVANLVTLAACLIHAVELKETGFHPQFFNVSGHLAVCVNFTEYVSHVQNKTWH---EALKLRPAH 152 Lactate dehydrogena...
ADO79962 161 FLTPSAMRWATTIACLFAILLAI 183 Porcine reproductive and respiratory syndrome virus
O55485   156 FMTPETMRWATVLACLFAILLAI 178 Porcine reproductive and respiratory syndrome virus
Q06500   153 FLSPSVVKWGTVITLVLAVLLAL 175 Lactate dehydrogenase-elevating virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap