Conserved Protein Domain Family
Sigma_1s

?
pfam02454: Sigma_1s 
Sigma 1s protein
The reoviral gene S1 encodes for haemagglutinin (sigma 1 protein), an outer capsid protein and a major factor in determining virus-host cell interactions. Sigma 1s is one of two translation products of the S1 gene.
Statistics
?
PSSM-Id: 111360
View PSSM: pfam02454
Aligned: 5 rows
Threshold Bit Score: 140.051
Threshold Setting Gi: 141409
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P32868   3 NQPTRNTRSRKLRNKLKTSLLMSTGSVTSLIQSKDNWVDYLYACQPLNRELVRTAIELIDSSEMSPAYRLALAESIRVYP 82  Mammalian orthoreovir...
Q85696   5 CQKGLNRGSRRLRKRPKYTLIQSSGSLRDSMMQINESSLLSKVGTIWLHQLVTRNLQSPDWKALSEPSKQLSMDLIRVLP 84  Reovirus sp.
Q85691   5 CQRALNQGSKRSRKRPKYTLIQSLGLLKDSMTQTNESSLLSKVGTIWLHQSVMRNLQSPDWKALSEPSKQLSMDLIQVLP 84  Reovirus sp.
Q85689   5 CQKGLNQGSRRSRRRLKYTLILSSGSPRDSMMQTNESSLLSKVGMTWLHQSVMLNLQSPDWKALPEPSKQLSMDLIRVLP 84  Reovirus sp.
P07938   1 MAPS-QKKSRKSRNKSRSTLMISGLPILNSTDLEDRLLTSAIASQPLSQDWVRWIIDLWVSRVRSRNYLTQVARTLRAYP 79  Mammalian orthoreovir...
P32868  83 SWVTESMLQNSELASWIQSRIISLsehQDWKLKYqpllMTLDH 125 Mammalian orthoreovirus 2 D5/Jones
Q85696  85 SWVVEWDSLRQDLQDYAMTTAVSL---REWVHRN----ATLDH 120 Reovirus sp.
Q85691  85 RLVAEWENLRQDLQDYALTMTVSL---REWILRN----VTLDH 120 Reovirus sp.
Q85689  85 NWVLEWDNLRQDLQSYALTTTISL---REWILRN----VTLDH 120 Reovirus sp.
P07938  80 HWVTESMLSNHELTVWIRSRLISL---DEHPLWR----QMLEA 115 Mammalian orthoreovirus 1 Lang
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap