Conserved Protein Domain Family
Adeno_E3_CR2

?
pfam02439: Adeno_E3_CR2 
Adenovirus E3 region protein CR2
Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host. This region called CR2 (conserved region 1) is found in Adenovirus type 19 (a subgroup D virus) 49 Kd protein in the E3 region. CR2 is also found in the 20.1 Kd protein of subgroup B adenoviruses. The function of this 50 amino acid region is unknown.
Statistics
?
PSSM-Id: 111345
View PSSM: pfam02439
Aligned: 9 rows
Threshold Bit Score: 35.0115
Threshold Setting Gi: 119073
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q76EL6   349 IPSATVTIVVGVIAGFVTLIIVFICYICCRKRPRAYnYM 387 Human adenovirus D8
Q80IV8   370 IPSTTVAIVVGVIAGVITIIIVILCYICRRKRPRAYnHM 408 Human adenovirus 8E
AET87200 145 IPKSTIGIITAVVVGLIIIFLCIMYYACCYRKHE-Q-KG 181 Human adenovirus 7d2
P35770   143 ISTSTISIIAAVTIGISILVFTITYYACCYRKDK-H-KG 179 Human adenovirus 11p
Q6QPG7   153 IPKSMIGIIVAVVVCMLIIALCMVYYAFCYRKHRLNdKL 191 Simian adenovirus E22
Q6H1B4   179 IPRSMIGIIAAVVVCMVIIILCMMYYACYYRKHRLNnKL 217 Human mastadenovirus E
Q2KSH6   135 IPNSMIAIIAAVALGMALIIICMFLYACCYKKFQ-H-KQ 171 Human adenovirus B3
P15137   136 IPDSMIAIVAAVAVVMALIIICMLLYACRYKKFHPK-KQ 173 Human adenovirus 35
Q6QPG6   159 CPGLLVSGIVGVLSGLAVIIICMFIFACCYRRLYRQ-KS 196 Simian adenovirus E22
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap