6XKX


Conserved Protein Domain Family
FixO

?
pfam02433: FixO 
Click on image for an interactive view with Cn3D
Cytochrome C oxidase, mono-heme subunit/FixO
The bacterial oxidase complex, fixNOPQ or cytochrome cbb3, is thought to be required for respiration in endosymbiosis. FixO is a membrane bound mono-heme constituent of the fixNOPQ complex.
Statistics
?
PSSM-Id: 460556
Aligned: 100 rows
Threshold Bit Score: 317.171
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6XKX_o                   7 HHVLEKNATLLLIFAFLVVTIGGIVEIAPLFYLE--NTIEK-VEGMRPYTPLELTGRDIYIREGCYVCHSQMIRPMRDEV 83  Rhodo...
CCG53117               488 HSWLERKPVQFIVLTTIAVAIGGIIQIVPMLIVK--SNIPT-ITSVKPYTPLELEGRDLYIREGCNNCHSQLVRPFRSEV 564
AEW86126               488 HAWLERKPVQLTVLATIAILIGGIIQIIPTIVVK--SNIPT-ISSVKPYTPLELEGRDLYIREGCVGCHSQMIRPFRSEV 564
BAH40817               513 HRSWERAPMLFTALTVLAVVVASLFEILPTFLIK--SNVPT-IASVKPYTPLELAGRDIYIAEGCFNCHSQMVRPFRYET 589
jgi:Plabr_3052         531 HRRWERMPMYFTFWVIVSVVAASLFEIIPTFLIR--SNVPT-ISTVTPYTPLELAGRDLYVAEGCYNCHSQMIRPILSET 607
Q7UQF9                 568 HRRWERLPVRFTVFTTIAVVVATLFEVIPTFLIR--SNVPT-IATVKPYTPLELAGRHIFVSEGCYNCHSQMIRPIVSET 644 Pirel...
WP_012376879           545 yerlllNALPFTVLTFLAVAAGGAIQIVPTVLVEkaQNVEDrIQV--VYTPLELAGRDIYVREGCYTCHSQMVRTLVPDV 622 Opitu...
jgi:Caka_1463          559 hekfLEHGFAFTVLTIAAAAIGGAVQIIPTVSFQhaGNVEDrLQV--PYTPLELAGRDIYITEGCYNCHSQMIRTMVPDV 636
PRJNA63271:OPIT5_02720 558 ydkllvhATPFTVLTFLAVAAGGMIQIVPTVIASraQNVEDrLQV--LYTPLELAGRDIYVREGCYNCHSQMIRTLVPDI 635
CBW26264               489 HRKLEGLTTLFSILTFLAVLVGGVVEIVPSLISD--KFVEK-DANIKPYSPLEIVGRDIFIKEGCYTCHSQHVRPMADEI 565
6XKX_o                  84 ERYG------HYSLAAESMYDHPFQWGSKRTGPDLARVGGRYSDAWHVEHLSNPQSVVPESVMPSYSYLANVP-LDSTWI 156 Rhodo...
CCG53117               565 KRYG------EYSKSGEYVYDHPFLWGSKRTGPDLMRVGGKYNHNWHFNHMWSPQATSTGSIMPAYKWLFDNKaMSHDDV 638
AEW86126               565 ARYG------DYSKSGEYVYDHPFLWGSKRTGPDLFRVGGKYNDNWHFNHMWDPQSTSAGSIMPAYKWLFDNKpADYSQI 638
BAH40817               590 ERFG------EYSKPGESVYEHPFLWGSRRIGPDLARQGGKYPDLWHVRHFEDPRAVTAKSIMPAYAHFSTTT-LDFNAI 662
jgi:Plabr_3052         608 KRYG------DYSKPGEFVYDHPFQWGSRRIGPDLAREGGKNSSLWHLVHFRDPNSLVKGSIMPTFGHLEQNE-LNFRSI 680
Q7UQF9                 645 KRYG------EYSKPGEFIYDRPFQWGSRRIGPDLAREGGKQSSFWHWTHFENPENVSPGSVMPAYGHLLTEE-MNYDAI 717 Pirel...
WP_012376879           623 LRYG------DYSRLGESIYDHPYQWGSKRTGPDLAREGGKYPNIWHIRHMADPRSISAGSIMPNYPWLLENN-TDVAVL 695 Opitu...
jgi:Caka_1463          637 MRYG------DYSRLGESIYDHPFQWGSKRTGPDLAREGGLRSDDWHYYHMLNPRDVSPGSNMPNYPWLFTKD-TKIHQL 709
PRJNA63271:OPIT5_02720 636 MRYGragvndDYSRLGESIYDHPYQWGSKRTGPDLARVGGKYTDDWHYNHMRDPR-MSPGSNMPAYPWLFDQV-TDTAAL 713
CBW26264               566 LRYG------AASRASESVYDRPFQWGSRRIGPDIARVGGKYNDMWHYRHMLDPREVTPKSIMPVYPWLFKKK-YDLKSL 638
6XKX_o                 157 EDRVSTDALVGVPYSAEMIAA-AKADFVAQADPNAD---SATLVANYGEKVnirnf-----dgkpgLTEMDALVAYLQVL 227 Rhodo...
CCG53117               639 QKKMAVMAKLGVPYTQEDIDG-ALASIEKQSAEIEEglkGDPKFVKAYDASkekarltgekfvpmkDREIVALIAYLQRL 717
AEW86126               639 EKKMEVMKTLGVPYTEEDIKK-AKASIAEQSTKIEAnlkNDPDFVKSYTESeknakmrkeefvpmrDREIVALIAYLQRL 717
BAH40817               663 QSRVDAMAMVGVPYGD-ALNR-APDMAREQAKQIAAaivEQGGPAGLE------------------DKQMVAIVAYMQRL 722
jgi:Plabr_3052         681 PERVQAAAYLGAPYSEEELTN-AIELAKQQARQIADdivKQKGPEGLE------------------DKQVIAMIAYLQRL 741
Q7UQF9                 718 APHVKVAAYLGAEYTDEELNN-TAEVAYKQAEYIAAdivAQGGPAKAY------------------EKQAVALIAYLQRV 778 Pirel...
WP_012376879           696 PAKIRVQQLLGVPFPERSAQQ-IFDAVKEQSTAMSQelrAAGAYVAP-------------------EKEIIALTAYLQTL 755 Opitu...
jgi:Caka_1463          710 PAKINAMRMLGVPYPIDLSEEdIQAQVDQQANEIVDrlaEKGAYVEP-------------------TKEIVALIAYLQKL 770
PRJNA63271:OPIT5_02720 714 PRKIDVQRQIGVPFPEWSEEE-IAAQVKKQETEVADrlkAKGLYTQP-------------------DREIVALIAYLQKL 773
CBW26264               639 PKKLRVMQSLGVPYSDEEIAS-SIDSASKQAFEITKglsADGVDMNMQ------------------SKEIIPLIAYLQRL 699
6XKX_o                 228 GTMV 231 Rhodobacter capsulatus SB 1003
CCG53117               718 GTDI 721
AEW86126               718 GTDI 721
BAH40817               723 GRDI 726
jgi:Plabr_3052         742 GTDI 745
Q7UQF9                 779 GVdl 782 Pirellula sp.
WP_012376879           756 GRSq 759 Opitutus terrae
jgi:Caka_1463          771 GTYe 774
PRJNA63271:OPIT5_02720 774 GTYe 777
CBW26264               700 GVdg 703
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap