Conserved Protein Domain Family

pfam02411: MerT 
MerT mercuric transport protein
MerT is an mercuric transport integral membrane protein and is responsible for transport of the Hg2+ iron from periplasmic MerP (also part of the transport system) to mercuric reductase (MerE).
PSSM-Id: 111318
Aligned: 3 rows
Threshold Bit Score: 170.821
Threshold Setting Gi: 75342506
Created: 19-Apr-2021
Updated: 29-Sep-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Q54462        80 SCAVPQVRKRRQVIFWLTALTALVLVTSNYWIVWFA 115 Shewanella putrefaciens
Q54462        80 SCAVPQVRKRRQVIFWLTALTALVLVTSNYWIVWFA 115 Shewanella putrefaciens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap