Conserved Protein Domain Family
PRRSV_Env

?
pfam02340: PRRSV_Env 
PRRSV putative envelope protein
This family consists of a conserved probable envelope protein or ORF2 in porcine reproductive and respiratory syndrome virus (PRRSV) also in the family is a minor structural protein from lactate dehydrogenase-elevating virus.
Statistics
?
PSSM-Id: 111251
View PSSM: pfam02340
Aligned: 4 rows
Threshold Bit Score: 339.601
Threshold Setting Gi: 81925652
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O55483  19 MLSRSSWCPLLISLYFWPFCLASPSPVGWWSFASDWFAPRYSVRALPFTLSNYRRSYEAFLSQCQVDIPTWGTKHPLGML 98  Porcine reproductive ...
Q04566  16 TPSLSSLLVWLILPFSLPYCLGSPSQDGYWSFFSEWFAPRFSVRALPFTLPNYRRSYEGLLPNCRPDVPQFAVKHPLGMF 95  Lelystad virus
Q06498   1 MRLYNLLCPYLTSWFFLVFCLALPSPAGCWFGLSDWFSPRSTVRVEKMTSLTFRSYFRDAIKLCRPDVIHFG-KG-FGLL 78  Lactate dehydrogenase...
Q83019   1 MHLFSSLFPSLIFWFSWAFFLGLPSPAGCWFGVSDWFSPRYSVRVERLTSLTYRRYFRDAIKLCQPDAIHYG-KG-FGML 78  Lactate dehydrogenase...
O55483  99 WHHKVSTLIDEMVSRRMYRIMEKAGQAAWKQVVSEATLSRISSLDVVAHFQHLAAIEAETCKYLASRLPMLHNLRMtGsN 178 Porcine reproductive ...
Q04566  96 WHMRVSHLIDEMVSRRIYQTMEHSGQAAWKQVVGEATLTKLSGLDIVTHFQHLAAVEADSCRFLSSRLVMLKNLAV-G-N 173 Lelystad virus
Q06498  79 WHMKVATMLDDVIHSRLMSHMSHQGRETWGQIFTHKALENIATPTFCPISSQMAGLEREACTYLLSRLPAIQAASAvY-N 157 Lactate dehydrogenase...
Q83019  79 WHMKIATMLDDVIHSRLMSHMSHQGRETWGRVFTQKALENIGRTQVVSHLQQIAGLEREACTYLMSRLPAIQAASAvY-N 157 Lactate dehydrogenase...
O55483 179 VTIVYNSTLNQVFAIFPAPGSRPKLHDFQQWLIAVHSSIFSSVAASCTLFVVLWLRVPILRTVFGFRWLGATFLS 253 Porcine reproductive and r...
Q04566 174 VSLQYNTTLDRVELIFPTPGTRPKLTDFRQWLISVHASIFSSVASSVTLFIVLWLRIPALRYVFGFHWPTATHHS 248 Lelystad virus
Q06498 158 VTIKF---LNQTVLIDFGPSNSSLSVAEHLWLVSMQSSVFSSVSAAVALWIVMLLRLP--KRVFGFPFMKRARRI 227 Lactate dehydrogenase-elev...
Q83019 158 VTIKF---SNETIAISFGPSNTSLTVAEHLWLVSMQSSVFSSVAAAFALWIVMLLRLP--RSVFGFLSMRRVRRT 227 Lactate dehydrogenase-elev...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap