Conserved Protein Domain Family
Glyco_hydro_70

?
pfam02324: Glyco_hydro_70 
Glycosyl hydrolase family 70
Members of this family belong to glycosyl hydrolase family 70 Glucosyltransferases or sucrose 6-glycosyl transferases (GTF-S) catalyze the transfer of D-glucopyramnosyl units from sucrose onto acceptor molecules, EC:2.4.1.5. This family roughly corresponds to the N-terminal catalytic domain of the enzyme. Members of this family also contain the Putative cell wall binding domain pfam01473, which corresponds with the C-terminal glucan-binding domain.
Statistics
?
PSSM-Id: 426720
Aligned: 2 rows
Threshold Bit Score: 1562.35
Created: 19-Apr-2021
Updated: 29-Sep-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P49331  281 LLMSWWPDKQTQIAYLNYMNQQGLGTGEnYTADSSQESLNLAAQTVQVKIETKISQTQQTQWLRDIINSFVKTQPNWNSQ 360  Streptococcus mutan...
P08987  269 LLMTWWPSQETQRQYVNYMNAQLGINKT-YDDTSNQLQLNIAAATIQAKIEAKITTLKNTDWLRQTISAFVKTQSAWNSD 347  Streptococcus mutan...
P49331  361 TESdtsaGEKDHLQGGALLYSN-SDKTAYANSDYRLLNRTPTSQTGK--PKYFEdnsS---GGYDFLLANDIDNSNPVVQ 434  Streptococcus mutan...
P08987  348 SEK----PFDDHLQNGAVLYDNeGKLTPYANSNYRILNRTPTNQTGKkdPRYTA---DntiGGYEFLLANDVDNSNPVVQ 420  Streptococcus mutan...
P49331  435 AEQLNWLHYLMNYGSIVANDPEANFDGVRVDAVDNVNADLLQIASDYLKAHYGVDKSEKNAINHLSILEAWSDNDPQYNK 514  Streptococcus mutan...
P08987  421 AEQLNWLHFLMNFGNIYANDPDANFDSIRVDAVDNVDADLLQIAGDYLKAAKGIHKNDKAANDHLSILEAWSDNDTPYLH 500  Streptococcus mutan...
P49331  515 DTKGAQLPIDNKLRLSLLYALTRplekdasnKNEIRSGLEPVITNSLNNRSAEGKNSERMANYIFIRAHDSEVQTVIAKI 594  Streptococcus mutan...
P08987  501 DDGDNMINMDNKLRLSLLFSLAK--------PLNQRSGMNPLITNSLVNRTDDNAETAAVPSYSFIRAHDSEVQDLIRDI 572  Streptococcus mutan...
P49331  595 IKAQINPKTDGLTFTLDELKQAFKIYNEDMRQAKKKYTQSNIPTAYALMLSNKDSITRLYYGDMYSDDGQYMATKSPYYD 674  Streptococcus mutan...
P08987  573 IKAEINPNVVGYSFTMEEIKKAFEIYNKDLLATEKKYTHYNTALSYALLLTNKSSVPRVYYGDMFTDDGQYMAHKTINYE 652  Streptococcus mutan...
P49331  675 AIDTLLKARIKYAAGGQDMKItyVEGDKshmDwdytGVLTSVRYGTGANEATDQGSEATKTQGMAVITSNNPSLKLNQND 754  Streptococcus mutan...
P08987  653 AIETLLKARIKYVSGGQAMRN--QQVGN---S----EIITSVRYGKGALKATDTGDRTTRTSGVAVIEGNNPSLRLKASD 723  Streptococcus mutan...
P49331  755 KVIVNMGTAHKNQEYRPLLLTTKDGLTSYTSDAAAKSLYRKTNDKGELVFDASDIQGYLNPQVSGYLAVWVPVGASDNQD 834  Streptococcus mutan...
P08987  724 RVVVNMGAAHKNQAYRPLLLTTDNGIKAYHSDQEAAGLVRYTNDRGELIFTAADIKGYANPQVSGYLGVWVPVGAAADQD 803  Streptococcus mutan...
P49331  835 VRVAASNKANATGQVYESSSALDSQLIYEGFSNFQDFVTKDSDYTNKKIAQNVQLFKSWGVTSFEMAPQYVSSEDGSFLD 914  Streptococcus mutan...
P08987  804 VRVAASTAPSTDGKSVHQNAALDSRVMFEGFSNFQAFATKKEEYTNVVIAKNVDKFAEWGVTDFEMAPQYVSSTDGSFLD 883  Streptococcus mutan...
P49331  915 SIIQNGYAFEDRYDLAMSKNNKYGSQQDMINAVKALHKSGIQVIADWVPDQIYNLPGKEVVTATRVNDYGEYRKDSEIKN 994  Streptococcus mutan...
P08987  884 SVIQNGYAFTDRYDLGISKPNKYGTADDLVKAIKALHSKGIKVMADWVPDQMYAFPEKEVVTATRVDKFGKPVEGSQIKS 963  Streptococcus mutan...
P49331  995 TLYAANTKSNGKDYQAKYGGAFLSELAAKYPSIFNRTQISNGKKIDPSEKITAWKAKYFNGTNILGRGVGYVLKDNASDK 1074 Streptococcus mutan...
P08987  964 VLYVADSKSSGKDQQAKYGGAFLEELQAKYPELFARKQISTGVPMDPSVKIKQWSAKYFNGTNILGRGAGYVLKDQATNT 1043 Streptococcus mutan...
P49331 1075 YFELK--GNQTYLPKQMTNKEASTGFVNDGN 1103 Streptococcus mutans UA159
P08987 1044 YFNISdnKEINFLPKTLLNQDSQVGFSYDGK 1074 Streptococcus mutans UA159
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap