6TBM,6T9K


Conserved Protein Domain Family
TFIID-31kDa

?
pfam02291: TFIID-31kDa 
Click on image for an interactive view with Cn3D
Transcription initiation factor IID, 31kD subunit
This family represents the N-terminus of the 31kD subunit (42kD in drosophila) of transcription initiation factor IID (TAFII31). TAFII31 binds to p53, and is an essential requirement for p53 mediated transcription activation.
Statistics
?
PSSM-Id: 426705
Aligned: 90 rows
Threshold Bit Score: 138.034
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6TBM_I         6 AAIPRD----VRLLHLIFATQNIYSYQDHVPLQLMDFAYRYTTGTLQDATIYSDHAHASGshisnagnagtnaqLTTEDI 81  Komagataella ph...
XP_016657330  36 KHTPKD----TQIIVSIMKDLGIVEYEPQVLNHLLEFNHRYTTLLLDDAKTFSNFAKKKN--------------VDADDV 97  pea aphid
XP_003242359   7 NRMPKD----SQTIVSMMNDLGIREYEQQVLNHLLEFNYRYTSLILEEAKACSTFANKEK--------------IDADDV 68  pea aphid
XP_001951696   8 NNMPKD----SQIIVSMMEDLGIVEYDQQVLNHFLEFNYRYTTQLLEDAKALSNSAKKKN--------------VDADDV 69  pea aphid
XP_015790995   6 ESSPRD----FGVITSILKEMGINEYEPKVVNQLLEFTYRYVTTVLEDARIYSQYADKKT--------------ITVDDV 67  two-spotted spi...
XP_015790994   6 KKLPKD----SGIIISLMKEIGITEFELKAVNQLLEFAYRYVTDILEDARLYSVHAEKSV--------------VTVADI 67  two-spotted spi...
1_pfamImport   2 GQFSKE----AQSIMGLLTEGGITEYDPRVVSMLMDVQYAVTTKILEMASGLSRHAEKSR--------------IDSDDV 63 
O45784        17 DGHSKE----ALAVISMLHECGIQEFDPRVVSMLMDVQYAVTSKILQMSSGLSRHAEKAQ--------------IEAEDV 78  Caenorhabditis ...
CDS40570       5 EQRPKDqlsvLSVIKSIFEDFNLVGLPEDVYNHVLDIISKYTGEILVDAKYNALYAGRSQ--------------VSEKDL 70  Echinococcus mu...
EFX80653       3 TKIPRD----ALVIQAILKDMGITEYEPRVINQLLEFIYRYVTTVLDDAKAYANHAKKKG--------------IDLDDV 64  common water flea
6TBM_I        82 RLA---IAARTNYQFKPVPPKELLLELAAERNKKPLPAVIPTWGIRLPPEKYCLTGKDWVLE 140 Komagataella phaffii GS115
XP_016657330  98 KIA---IQLAQDGIFCRPPPRDMLMTASREVNKIPLPPVRPASGLRIPQDRSTFLQTNYRLK 156 pea aphid
XP_003242359  69 KMA---IQMARDGVFLKSPPRDELIKASNELNKKPLPAIKPASGLRIPQNGSSFLQAKYRLK 127 pea aphid
XP_001951696  70 KLA---IQMVQDGVFPGPPPRKVLTTAAIEVNKMPLPPQRHASQLRISHDSPNSVKTKYRLR 128 pea aphid
XP_015790995  68 KMA---IQSQSEKMLTLPPPQDFLMEIARTRNNQPLPPIRSIVGPCLPPDRYSLISCNYHsk 126 two-spotted spider mite
XP_015790994  68 KLA---IQSRSEKMSPELPPRNLLMDIAYDINSEPMPLIRQNNGLRLPPERFSLITANQRnk 126 two-spotted spider mite
1_pfamImport  64 QTAadmLGVLGS----SAPDREKMLLLAQDKNAQPLPAIRHNYGLKLPNDRFCQLQQNLVYK 121
O45784        79 QTAadmLGVLTT----NAPDREKILQLANDKNQQPLPQIRHNYGLKLPNDRFCQLQQNFVYK 136 Caenorhabditis elegans
CDS40570      71 NLA---VENKMENVMLAPLHRAQLLEYAEKINSQTLPSIKSGPGLKLAPEKYTITAPNYCIT 129 Echinococcus multilocularis
EFX80653      65 KLA---VSMQMEQSFTSPPPREILMEVARSKNSTPLPSVKPHCGIRLPPDCHCLAACNYKLK 123 common water flea
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap