7DR6,6DFK,7DR6


Conserved Protein Domain Family
PA28_beta

?
pfam02252: PA28_beta 
Click on image for an interactive view with Cn3D
Proteasome activator pa28 beta subunit
PA28 activator complex (also known as 11s regulator of 20S proteasome) is a ring shaped hexameric structure of alternating alpha and beta subunits. This family represents the beta subunit. The activator complex binds to the 20S proteasome ana simulates peptidase activity in and ATP-independent manner.
Statistics
?
PSSM-Id: 460508
Aligned: 58 rows
Threshold Bit Score: 184.645
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
7DR6_B       103 PVNCNEKIV-VLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSER 181
EKM61400     113 QMVANQHIQ-KVHGILKKECEELADSIDKVKLWINLSMPKIEDGDNFGVQIQEEVLNELHRSQESAYNLRDAARQSHFNR 191
EPT01604     126 LVTANQYVD-KVHAIVKKECEQLADSCDKVKLWVNLSMPKIEDGDNFGVQIQEEVLTELHRSQESAYNIRDAGRQDHLHR 204
EGO02578     104 LVHANAHII-KLNADIKKECTQLADLCEKVKLWVNLTMPKSNFRHFLGVQIQEEVLTELHRSQESAYNLRDGIRQDYLAR 182
XP_007842595  98 LVKSNFHAK-SLHDVVKKECEEIATLIDHIKLWVTLRMPRIEDGDNFGVQVQEEALAELHRAQESAYNIRDVPRQDYLSR 176
XP_003038805  98 SVAANQRLL-GLHDVIKRECEQLGTLVEQVKLWITLTMPKIEDGDNFGVEIQTEVLNELDRVHQSAYNLRDLARQHHLER 176
XP_001883313  45 LVYDNPRIQ-KIHEVISKQVEEMMLLSEQVEVWIILTIPQIEDGDNFGVQVQEKVLDQILIADKSATIFRSAALDHHLDH 123
XP_003331090 110 HVASNPKVN-AHFIFLRTHWEELINITNAIKIHINLLIPKIEDGDTFGVQVQEECLSELSRAQDSGYNLLEAQLKHNMSR 188
KIS72303     117 VVHTPAFLM-RAFDELRIEWDQLIETMDSLKIYINLQMPQIEDGDTFGVSIQEEALNEIIRTQESAYTLISTPFTYHSTR 195
EAU92746     109 HVKANDHMTnKIYNFVKKECEELADLTDQVRLWVTLTLPKIEDGDNFGVHVQEEVLGELQRAQESALAIRDLPRQDHLTR 188
7DR6_B       182 GDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGM 247
EKM61400     192 AKLCSKILKYPHIEDYLLALKEHDEKQLYVAKQNLYDIRNVYAILTDILHKNIGKLRTPKGNNATG 257
EPT01604     205 AKICSKIVKYPHLEDYALALKEHDEKQIYVARQNLFDLRNVYAILTDILHKNIAKIRSPKGNNLSG 270
EGO02578     183 AKICSKVIKYPHVEDYTLALKEQDEKQLYLARQHIVDIRNVYAILTDIIHKNINKICSPKGNNGVG 248
XP_007842595 177 AKICSKLIKYPHVEDYTLALQEHDSKQIYYARQRLYDIRNLYAALTDVLHKNIAKIRAPKANNRTG 242
XP_003038805 177 AKICSKLIKYPNIEDYTMALREHDEKHVRVARENLTDVRDLYAVMTDLIHKNITKIRAPKANNNSG 242
XP_001883313 124 ARICSKLCKYPNVKDYARALEEHDKRQIYIARERLREIRNEYAILVDVIQKNISKIRVPKANHGGD 189
XP_003331090 189 AKLASKLIKYPNVEDYQLALQEHDRKSIFLCRQHLLDLRNIYALLTDLLHKNIVKITKPKGANSDG 254
KIS72303     196 GDLAAKLVKFPGVQDYEKAILEHDRKTVYRLKMYLTDIRNMYAVVFDIVKKNIGKISKPKSGNQMG 261
EAU92746     189 AKICSKLIKYPNIEDYALALRDHDEKQFYFARQHLYDIRNVYASITDMMQKNISKIRTPKSNNRAA 254
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap