6T0B


Conserved Protein Domain Family
COX7a

?
pfam02238: COX7a 
Click on image for an interactive view with Cn3D
Cytochrome c oxidase subunit VII
Cytochrome c oxidase, a 13 sub-unit complex, is the terminal oxidase in the mitochondrial electron transport chain. This family also contains both heart and liver isoforms of cytochrome c oxidase subunit VIIa.
Statistics
?
PSSM-Id: 426673
Aligned: 79 rows
Threshold Bit Score: 40.9908
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6T0B_g         2 NKVIQLQKIFQSSTK-PLWWRHPRSALYLYPF-YAIFAVAVVTPLLYIPNAIRG 53  Saccharomyces cerevisiae S288C
EIE85455       8 NNVLANQRYFQAPSNtLLFLRGPRDKLFVYST-AAVLGVGLVGALYGAVNMARG 60 
EPB82169       8 NHVPEHQRYFQQPSNkLLFLRGPRDKLFVYGT-FLVLGTGLVGSLLGAVKMarv 60 
EPB86880       8 NNVAAQQRFFQAPSNtLLFLRGPRDKLFVYTT-FLVLGTGVAGSLWGAVNMARG 60 
EPB90117       7 NNVLANQRYFQAPSKtPLWIRGPRDKFIVTIV-FAGLGVGVVGSLIGAGKMIVG 59 
XP_004961871  20 EKILEKQRYFQS-VHkPTYLKGRYDVITSVAIpLALAVSSMYLVGRGIYNMSHG 72 
XP_009416167  10 ERLLKHQQYFQH-VHkHTYLKGRFDKITSVAIpLALTVSSLALIGRGIYNMSHG 62 
KRH26589      10 EKLIEKQKYFQN-IHkHTYLKGPYDKITSVAIpLALAATSLYLIGRGIYNMSHG 62 
XP_002869908  11 EKLLEKQRLFQS-IQrHTYLKGPMDKITSVAIpIALAASSLYMIGTGIYNMSNG 63 
CBI17065      43 ERLFEKQRFFQS-IHkHTYLKGPMDKITSVAIpAALAATSIALIAQGIYNMSHG 95 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap