1UJS,5VNT,2K6M


Conserved Protein Domain Family
VHP

?
pfam02209: VHP 
Click on image for an interactive view with Cn3D
Villin headpiece domain
Statistics
?
PSSM-Id: 460493
Aligned: 187 rows
Threshold Bit Score: 48.1438
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1UJS_A         47 HLSQEEFYQVFGMTISEFDRLALWKRNELKKQARLF 82   human
EFA79213     1322 YLSDSDFENLFKMDKATFAQQKIWKQENLKKSFAIY 1357
XP_021206834  822 YLTHDDFVATFGMPYSEFRTLPGWKQKDLKKAVGLF 857 
EFA03188      805 HLTHDDFVSVLKMTYLEFEKLPRWKQQELKKRAGLF 840 
1_pfamImport    1 HLTNDDFISIFNMTYKDFEALPPWKQQELKKKNKLF 36  
EDW55571      852 HLTHDDFVSVFNMSFYEFDELPKWKKMELKKQFKLF 887 
ETN66171      873 HLTHDDFVTVFNMTYHEFEELPKWKQVELKKQRKLF 908 
XP_004995544 1269 ALTRRDFLECFGMTPEDFAYLPRWSRMQQSKRVFLQ 1304
EDQ91475     1092 YLSPSDFRQVFNMSRDDFVKLPLWRQQQKKKLARLF 1127
EDO45796      871 YLSNSDFQEVFKMGKEDFTKLPGWKQQNLKKAVKLF 906 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap