3JB9


Conserved Protein Domain Family
HAT

?
pfam02184: HAT 
Click on image for an interactive view with Cn3D
HAT (Half-A-TPR) repeat
The HAT (Half A TPR) repeat is found in several RNA processing proteins.
Statistics
?
PSSM-Id: 111114
View PSSM: pfam02184
Aligned: 3 rows
Threshold Bit Score: 55.2644
Threshold Setting Gi: 74956757
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3JB9_R 185 HENERARGIYERFVVVH-PEVTNWLRWARFEEE 216 Schizosaccharomyces pombe 972h-
P17886 191 KEIDRAREIYERFVYVH-PDVKNWIKFARFEES 222 fruit fly
O16376 201 KEIDRARSVYQRFLHVHgINVQNWIKYAKFEER 233 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap