Conserved Protein Domain Family
7TM_GPCR_Srb

?
pfam02175: 7TM_GPCR_Srb 
Serpentine type 7TM GPCR chemoreceptor Srb
Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type. Srb is part of the Sra superfamily of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf'.
Statistics
?
PSSM-Id: 111105
View PSSM: pfam02175
Aligned: 3 rows
Threshold Bit Score: 280.546
Threshold Setting Gi: 52001260
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
A0A3B1DZW5  17 YHPFYMIAQFWSFFVSLLAMPSLIFFMVEKVFKLPFHGNLKFLLVSYFIGTFLFASIICFTFGYHFFVPFFVTSNCDLII 96  Caenorhabditis el...
P83260      27 FHPVYRVAQIYQFLVACFAFPPLFYFIFFKLIKSSFHGNLKCVLIGYFVTVLAFTINFQIVGFVQVLLPFISRTPCDLII 106 Caenorhabditis el...
Q20963      17 FNTVYRFSQFYTFSVSSFAVPGLIYFMFKRLFQLYFHGNLKTLLIAYFISILLYAVMLCFAFGYQFFVPFFIKSNCDLII 96  Caenorhabditis el...
A0A3B1DZW5  97 NATLFKYGHMIALIFMTIPMILPTAFTVERFVALKMAHSYEHVRTLLGPVLVLVVIAIDSMFLYDIYGQEKFDKPFINFI 176 Caenorhabditis el...
P83260     107 NGRYLKYGHPTGSFIMTLSTLLPICITIERFFAMKNAETYEKTPVKLGPIITFLLIIIDLTTVSMIHRNSNFDAGSISFV 186 Caenorhabditis el...
Q20963      97 NKTLFKYIHTSVIFLLTTPMMFPLGFSIERFTAMAMASRYENIRTLIGPVLVIFLIIPNCIIFYFLFQHETYDDTFISFL 176 Caenorhabditis el...
A0A3B1DZW5 177 LVPATSA-LQFNSFLWYMLYLKITNFICNLILLFIHKILHQssryrrKNVSLSVKYEMQEISQSSRFTLIVTFTHLLFF 254 Caenorhabditis ele...
P83260     187 IFPSLEVgLTMMKFFIIIVIFNVINFLFNIKLIRDNAKLKS------INSTLSTKFQLEEVYFSTMFVITVVFYHVAFF 259 Caenorhabditis ele...
Q20963     177 MLPNTTA-VNFNTYLWFLLYLNIGNLALNVLLLLVHRKFKRrl--llHKTSLSTRYAIEEISQSSKFTLIITFTHLLFF 252 Caenorhabditis ele...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap