4GC8


Conserved Protein Domain Family
FliM

?
pfam02154: FliM 
Click on image for an interactive view with Cn3D
Flagellar motor switch protein FliM
Statistics
?
PSSM-Id: 111086
View PSSM: pfam02154
Aligned: 7 rows
Threshold Bit Score: 257.305
Threshold Setting Gi: 300680950
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4GC8_A    15 YDFKRPNRVSKEQLRSFRSIHDKMARNLSSQVSSIMRSIVEIQLHSVDQMTYGEFLMSLPSPTSFNVFSMKPMGGTGVLE 94  Helicobacter pylori...
P0CG26    77 RAIINSALVSYERLPMLEIVFDRLVRLMTTSLRNFTSDNVEVSLDNISSIRFGDYLNSIPLPGILAVFRAEELDNYGLLT 156 Caulobacter vibrioi...
P06974    38 YDPNTQRRVVRERLQALEIINERFARHFRMGLFNLLRRSPDITVGAIRIQPYHEFARNLPVPTNLNLIHLKPLRGTGLVV 117 Escherichia coli K-12
CAV17824  37 FDFSSQDRIVRGRMPTLELINERFARHMRISLFNMLRKTAEVSINGVQMMKFGEYQNTLYVPTSLNMVRFRPLKGTALIT 116 Vibrio tasmaniensis...
P23453    40 YDFKRALRFSKDQIRSLTRIHDNFARLLTTHFSAQLRTYIHISVSSVDQVPYEEFIRSIPNMTILNLFDVHPMEGRIMME 119 Bacillus subtilis s...
P74927    39 YDFRRPDKFSKEQMRTLSLMHETFARLTTTSLSAQLRSMVHVHVASVDQLTYEEFIRSIPTPSTLAVITMDPLKGNAVLE 118 Treponema pallidum ...
Q57511    49 YDFKRPDKFSKEQVRTVSSFHEAFARYTTTSLSALLRKMVHVHVASVDQLTYEEFIRSIPNPTTLAIINMDPLKGSAIFE 128 Borreliella burgdor...
4GC8_A    95 INPSIAFPMIDRLLGGKGSAYD---QNREFSDIELNLLDTILRQVMQILKEVWSPVVEMFPTIDAKESSANVVQIVA-QN 170 Helicobacter pylori...
P0CG26   157 VDSNLIYSIVDVLLGGRRGTAAmriEGRPYTTIERVLVQRMIDVVLHDLKSAFEPLHPVSFSLDRLETNPPFAAIAR-PA 235 Caulobacter vibrioi...
P06974   118 FSPSLVFIAVDNLFGGDGRFPTk-vEGREFTHTEQRVINRMLKLALEGYSDAWKAINPLEVEYVRSEMQVKFTNITTsPN 196 Escherichia coli K-12
CAV17824 117 MEARLVFILVENFFGGDGRFHAk-iEGREFTPTERRIIQLLLKIVFEDYKEAWSPVMGVEFEYLDSEVNPSMANIVS-PT 194 Vibrio tasmaniensis...
P23453   120 VNPTIAYTMMDRVMGGIGISHN---KVDSLTEIETKIISNLFENALGNYKEAWQSIADIEPEMTEFEVNPQFVQMVS-PN 195 Bacillus subtilis s...
P74927   119 VDPSITFSIIDRLFGGTGQAAK---VQRDLTDIENSVMEGVIVRILANVRESWTQVIDLRPRLGQIETNPQFAQIVP-PS 194 Treponema pallidum ...
Q57511   129 VDPTIAFAIVDRLFGGDGDTIKd--KSRDLTEIEQSVMESVIIRILANMREAWSQVVDLRPRFGHIEVNPQFAQIVP-PT 205 Borreliella burgdor...
4GC8_A   171 EISIMVVLEIIIGHSRGMMNICYPVISIESILSKM 205 Helicobacter pylori 26695
P0CG26   236 NAAILVKLRIDMEDRGGRIELLLPYATLEPIRKML 270 Caulobacter vibrioides CB15
P06974   197 DIVVNTPFHVEIGNLTGEFNICLPFSMIEPLRELL 231 Escherichia coli K-12
CAV17824 195 EVIVVSSFHIEVDGGGGDFHVVMPYSMVEPIRELL 229 Vibrio tasmaniensis LGP32
P23453   196 ETVVVISLNTQIGEISGVINLCIPHIVLEPLIPKL 230 Bacillus subtilis subsp. subtilis str. 168
P74927   195 EMVVLVTLETKVGEEEGMMNFCIPYITIEPIISKL 229 Treponema pallidum subsp. pallidum str. Nichols
Q57511   206 EMIILVTLEVKIGKVEGLMNFCLPYITIEPIVSKL 240 Borreliella burgdorferi B31
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap