1T77,1MI1


Conserved Protein Domain Family
Beach

?
pfam02138: Beach 
Click on image for an interactive view with Cn3D
Beige/BEACH domain
Statistics
?
PSSM-Id: 460459
Aligned: 272 rows
Threshold Bit Score: 176.512
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1T77_A        138 QRW-QHREISNFEYLMFLNTIAGRSYNDLNQYPVFPWVITNYESEELDLTLPTNFRDLSKPIGALNPKRAAFFAERYESW 216 
Q586X6       2825 AGW-GGRSVSTFEYLFFLNRAAGRTILDYNQYPIFPWVIADYRSSTLDLSSDSTYRDLSRPMGAQTKERRRSVEDLYQQM 2903 Trypanosoma b...
CAM40838     4104 VRW-ATGSLSNYEYLRFLNEVAGRTNRDLNQYPIFPWVLADYTSTTLDLEAASTFRDFAYPMGAQTETRRAAAAKLYENT 4182
Q384U3       2369 CNWwREGRITNFHYLMYLNFAAGRSYGDMRQYPVFPHVVADFSSLTLDLTSPSTYRCLKRPIGAQTPEGIQRAAKTYAET 2448 Trypanosoma b...
XP_002113197    1 -RW-RDGKISNFHYLTQLNKIAGRSFNDLMQYPVFPFVLSNYTETTLDLTCPESFRDLSKPIAAQNEDRAKKYKENYQVE 78  
EFX82856       80 QLW-RESQITNFEYLVFLNKFAGRSYNDLMQYPIFPFVLADYESPVLDLDDPHVYRNFKKPMAVQNESRDQHYIENYNYL 158 
EDW50149     1778 QQW-REGLLTNWEYLMTLNQISGRTYNDLMQYPVFPWVLANYNSEVLDLREGHNFRRLGRPIAVQVEENEKHYISNYTYI 1856
EFN65741     2775 TLW-RSGALTNWEYIICLNKLAGRSYNDLMQYPVFPFVLADYVSDKLDLNDPKIYRNFKRPMAVQDKKNEQHYINNYNYL 2853
XP_016656580 2683 DLW-RTRQITNMEYLSILNKMAARSYNDLMQYPVMPFVLASYNTTELDLNQLSTYRDLRRPMAIQNKKKEAHYIQHYNYL 2761
XP_021204141 2645 AQW-RSGSITNWEYLMRLNGLGGRSYNDLMQYPVLPFVLADYTSKILDLDDPNTFRDLSRPVAVQDKKREHHYINTYNDL 2723 domestic silk...
1T77_A        217 ---EDDQv----------PKFHYGTHYSTASFVLAWLLRIEPftTYFLNLQGGKFDHADRTFSSISRAWRNSQ-RDTSDI 282 
Q586X6       2904 mevAQQLgdggvaameltQPFHHGTHYSTSGGVLYYLIRMEPftTFARIFQGGDFDVASRLFDTIDGSFQSCV-NGPADC 2982 Trypanosoma b...
CAM40838     4183 r--EVCDvgk-----geaHPFHHGTHYSTSGGVLYFLVRAQPftTYARLFQGGDFDLAMRLFDSVAASFASCM-SGSADC 4254
Q384U3       2449 s-tDVGMavea---sccgSPYHYGSHYSPLGGALHYLVRVQPfsDFFMKM-NSKLDDAGRVFDSVGAAYAIAT--CGKDV 2521 Trypanosoma b...
XP_002113197   79 i--YYYHsl-------ldLPYHYGSHYSNSGTVLHFLVRVPPytQMFIDYQDQSFDLPDRTFHSMATTWRLSSyESTTDV 149 
EFX82856      159 k-rDFENrpegs--gpnfGPFHYGSLYSNPGIVLHFLVRLPPftKLLMEYQDRNFDVPDRSFHSVGTSWRLASsDSTTDV 235 
EDW50149     1857 d-sTNTTmgs-----lilKPYHYSSHYSNSGTVLHFLVRVPPftSYFLRYQDNDFDLPDRTFHALNTTWLLASrDSPTDV 1930
EFN65741     2854 k-qTLTEglnli--alnqGPFHYGSHYSNSGTVLHFLVRLPPftSMFLCYQDNNFDIPDRTFHALATTWRLTScDSTTDV 2930
XP_016656580 2762 k--EDIHnf-------gtDPHHYSSHYSNSGTILHFLIRVPPytQMFIKYQDNNFDVPDRSFHSMEITWRLSSdESTTDL 2832
XP_021204141 2724 k-aARREacss---qlsrLPHHYASLYSNSGAVLHYLVRLPPftELFLNYQDNNFDMPDRTFHSLATTWRLITkDSPTDV 2799 domestic silk...
1T77_A        283 KELIPEFYylPEMFVNFNNYnlgvM-D-DgtVVSDVELPPWAkTS-EEFVHINRLALESEFVSCQLHQWIDLIFGYKQQG 359 
Q586X6       2983 KELTPEFFldGSFLVNMNRCnfgtKsDgT--AVDDVKLPPWAkDSaQVFTAVMRYILESDRVAHSIHHWIDLVFGVCRRG 3060 Trypanosoma b...
CAM40838     4255 KELIPEFYvnSGFLANADHLhlgtKsNgE--AVDDVRLPPWAkNSqQVFTAVMRYALECPYVVEHLHQWIDLVFGVRRRG 4332
Q384U3       2522 KELLPEFYclPELFVNANRIpfgtK-Q-DgeVVNDVQLPPWA-STpRKLSQTLRRALEGCYVSENLHSWIDLIFGFRQRG 2598 Trypanosoma b...
XP_002113197  150 KELIPEFYylPDFIKNFEGFdfgkR-Q-TgeKVNDVCLPPWCeNNaRLFILIHRQALESACVSRSINKWIDLIFGCKQTG 227 
EFX82856      236 KELIPEFFylPEFLVNALGFdfgmQ-Q-SgdPVDDVQLPPWSlGKpRLFIQIHRQALESSWVRDHLHHWIDLIFGFKQTG 313 
EDW50149     1931 KELIPEFFclPEMFENFERFkfgcR-Q-NgeRVEDVSLPPWSqRDsRLFVLIHRQALESELVRNQIHNWIDLIFGYKQSG 2008
EFN65741     2931 KELIPEFFylPEFLLNFEGFnfgvR-Q-NgnKVGDVELPKWCgGDvRLFILAHRAALESDIVREVLPYWIDLVFGFRQTG 3008
XP_016656580 2833 KELIPEFYylPEMFMNFEQLnfgvK-Q-SgeIVDSVKLPTWAqNNpRLFVLIQRQLLESEIVSENLPHWIDLIFGYKQTG 2910
XP_021204141 2800 KELIPELFylPELFYNNEGLnlgiR-Q-CgeGIDEVELPPWA-ADaRLFTLLHRQALEAAHVSETLPHWIDLVFGHKQTG 2876 domestic silk...
1T77_A        360 PEAVRALNVFYYLTYEgavnlns-itdpvlRe--AVEAQIRSFGQTPSQLLIEPHPPR 414 
Q586X6       3061 KLAVDCHNVFQRMTYGeevvkal-kesqnsRdidVIVAEVDNFGQTPMQLFQEHHPPQ 3117 Trypanosoma brucei
CAM40838     4333 PLAVERYNVFQRMTYGeevaqal-knaetpHdcdVIIAEVDNFGQTPPQLFQELHPSH 4389
Q384U3       2599 KEAVAALNTFHPLTYEgsvnlpn-isddvlRs--SHETQIDCFGQTPLQLFSQPHKSR 2653 Trypanosoma brucei
XP_002113197  228 KDAIEAINVFHPSTYKvadmdt--ikdpikRn--AYLTMVNTYGQTPLRLFRNPHVEK 281 
EFX82856      314 PSAIESINVFHPSTYAgfdtteglnddpieRn--AKLTMIRSYGQVPRQLFRQPHPMS 369 
EDW50149     2009 ESAVEAINVFHPATYAvfldse--isdpieRe--AVKTMVKTYGQMPRQLFKSPHPAS 2062
EFN65741     3009 KPAVEAINVFHPATYYgfdveq--isdsleRq--AWETMIRTYGQTPAQLFRTPHPLI 3062
XP_016656580 2911 KAAIDAINVFHPATYYgshiee--tedpvaRs--AFKTMISTYGQTPRQLFRFPHPMT 2964
XP_021204141 2877 PAALDAINvfdaqTYYgfdpda--ledevdRs--AACAMVRTYGQVPRRLLRQPHPHA 2930 domestic silkworm
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap