1KCM


Conserved Protein Domain Family
IP_trans

?
pfam02121: IP_trans 
Click on image for an interactive view with Cn3D
Phosphatidylinositol transfer protein
Along with the structurally unrelated Sec14p family (found in pfam00650), this family can bind/exchange one molecule of phosphatidylinositol (PI) or phosphatidylcholine (PC) and thus aids their transfer between different membrane compartments. There are three sub-families - all share an N-terminal PITP-like domain, whose sequence is highly conserved. It is described as consisting of three regions. The N-terminal region is thought to bind the lipid and contains two helices and an eight-stranded, mostly antiparallel beta-sheet. An intervening loop region, which is thought to play a role in protein-protein interactions, separates this from the C-terminal region, which exhibits the greatest sequence variation and may be involved in membrane binding. PITP alpha has a 16-fold greater affinity for PI than PC. Together with PITP beta, it is expressed ubiquitously in all tissues.
Statistics
?
PSSM-Id: 460452
Aligned: 97 rows
Threshold Bit Score: 190.861
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1KCM_A         1 VLLKEYRVILPVSVDEYQVGQLYSVAEASKNET-GGGEG-----------VEVLVNEP-YEK-----DDGEKGQYTHK-- 60   house mouse
EJW04480       3 IIHKEYRIVMPITTQKYNICQLYTVAALSKSES-TGDTS-----------IKIVENKD-YDH-----EVLGHCRKTHK-- 62  
EIJ88733       3 QRTTLYVMYMPYTLKEYNVGQLLTTCRVSEREA-DKGMR-----------VAVLENKPiKNE-----ETAEPCQYTSK-- 63  
EHY65326       3 QRTTLYVIYMPYTLKEYNVGQLLTTCRVSEREA-NNGMR-----------VTVLENKAvESE-----ETAGPCQYTSK-- 63  
EPR78833       4 TKRVEFRIPLPFHIDKYLVGQLYTVAHMSQAEA-KKGSP-----------IQILENYD-ISH-----EKYGECRKTKK-- 63  
ELA46375       3 TIYREYQIPLPFTIKDYRVAQLYTVAMISANEA-TGDTS-----------IKIAENKD-IHD-----EKYGACRYTEK-- 62  
EAY17157       1 MRIIEWRVIVPMTVQQYQIAQIYAVAKKTLEDS-NDKEG-----------IERTSSEM--------------RKYNEKda 54  
EAY21809       1 MKIYEYRVILPTNVPQYQIGNLYMCAQRTRETQ-GGGEG-----------IEILKNEP-YQE------GEEKGQYTHK-- 59  
XP_001614288   1 MKLIEFRLAMPLTMEEYKICQQYLLAKVSHEDTeNTIHGvghnkktdgrsLVLFKKGT-YDD-----ENGEPGDYTFK-- 72  
Q965T2         1 MSVEEYQVGQLWSVAEASKAETGGGEGVEVLKN-EPFDN-----------VPLLNGQF-TKGqythkIYHLQSKVPAI-- 65   Caenorhabditis...
1KCM_A        61 -----IYHLQSKVPTFVRMLAPEG-ALNIHEKAWNAYPYCRTVITNE-YM----KEDFLIKIETWHK--P-DLGTQEN-- 124  house mouse
EJW04480      63 -----ILNLNSKVPYIIRKCMPSNdALKLVETAYNAYPKCSTTYTNKyFN----ENTFKMTVNSVHV--D-GVDFQDN-- 128 
EIJ88733      64 -----VLDFSKKVPGFFRAIAPSG-SLTMSEISYNAFPVCKTTYTSGaLS----EKKFKARIDTLFF--EgHKPPVDP-- 129 
EHY65326      64 -----VIDFSKKVQSFLRKIAPSG-SLTMSEKSHNAFPVCKTVYTSGaLS----EKKFKARIDTLFL--EgHKAPIDP-- 129 
EPR78833      64 -----LLNISKKVPSIIKALVPKK-ALLIEEIAYNAFPNCVTTYTNQqFK----PEKFNVSITSTHL--N-GYEQQEN-- 128 
ELA46375      63 -----IFYLNSKVPRAIRAVVPKK-ALIVEEKAFNAFPTCHTFYTNQaFS----TDTFSASVVSTHV--N-NELTLKN-- 127 
EAY17157      55 lysqyIYSFANKLPSALRWVLPNT-LSTLVEDCYDQFPYQHSH-----FVlkdnEKTLNMTVTTVVS--E-FQNNEENli 125 
EAY21809      60 -----VMHFKSKVPGAIRWAIPDK-YLHIDEKSHNSYPHFHTLYEQKgMG-----KDFYLLVESQHMvyDrEKGVPDN-- 126 
XP_001614288  73 -----RMNLVNKIPKWLLNFVDPK-YCLIDEKSWNSYPYLKTVYEATgF------PKAQVQVESTHH--I-GYNTEDN-- 135 
Q965T2        66 -----LRKIAPKGSLAIHEEAWNA-YPYCKTVVTNPDYMKENFYVKIeTI----HLPDNGTTENAHG--L-KGDELAK-- 130  Caenorhabditis...
1KCM_A       125 ---VHKLEPEAWKHVEAIYIDIADRS--QvLSKDY------KAEEDPAKFKSVKTGRG---PLGP-NWKQelvnqKD-CP 188  house mouse
EJW04480     129 ---INEMPANIWKNTKVDYIDIAVDG-------EY--------EVKPSDYISQKAKIG---PLHK-GWIEdf-kkQN-IP 184 
EIJ88733     130 -------FTDGIVAERCEVLDLVHGQ-------QI------AENINLAEIKDESGN-----LLFPaDWEK-----SH-TP 178 
EHY65326     130 -------FSDGIISENCEVLDLVYGQ-------QM------CEGIDLATVKGDDGN-----LLFKeGWEK-----EH-TP 178 
EPR78833     129 ---VFGIEEEEYKKVKKVILDVSSSP----VDEEY--------DTRIAIVNHMVC------PMNE-KWIEkq--kEKnLP 184 
ELA46375     128 ---ALNIDCALYDKTKVKVIDVCCNI----VNPQY----------DPTNTPLKINDGC---PLKP-EWYK-----NPsYD 181 
EAY17157     126 kndAELYTKEELAKREIHYIDIVNWP--T-EEEGVkvgefeCPQANIEKLPKATVNNKdtlP----EWVKe----YK-GP 193 
EAY21809     127 ---ALNLTPEELKQRQIFYLDIVNSKpkP-EKPEWdmhnfeCPEAKISKLSTPKNTCD---ETKPpEWTL-----TYeGD 194 
XP_001614288 136 ---AFNISDEQLAQRKVVLIDIVNDK--V-AYKDY------LPEEDPTIFYSERAQRG---KLDE-NWIE-----NS-KV 193 
Q965T2       131 ---REVVNINIANDHEYLNSGDLHPDstP-SKFQS------TKTGRGPLSGNWKDSVQ---PVMC-AYKL-----VT-VY 190  Caenorhabditis...
1KCM_A       189 YMCAYKLVTVKFKWWG-LQNKVENFIH-KQEKRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETK 251  house mouse
EJW04480     185 LMTCYKQVSIEINCFG-LGWLVNE-VE-KQLRKIFATSHQQMFCQMDDWYDLTIEDIRKIEEETK 246 
EIJ88733     179 VMTIFKRVHIDLNIPI-IGKRYIEDID-KFMRKMFTQGHQEVIKYYNEWKNMTMDDVRKEEEKTK 241 
EHY65326     179 VMTIFKRVHIDLHIPF-IGWKYIEDVD-KFMRKMFIQGHQEVIKYHSEWKDMDMDGVREEEAKTK 241 
EPR78833     185 MMYCYKLVEINSNIWG--GSIIAKGVI-SEFSKMFLAFHQQLVCTMCEWENMNLDAIRVLEDKLK 246 
ELA46375     182 VMMSYKFVTLKFDCFG-LGWLVHE-IE-KQIDKIFTSSHQQMVCTMDEWHGKSIEDIRELEDNIR 243 
EAY17157     194 MVIARKIIRINIDIFA-IGGPTEEFIGkQFMPNIYANSHQRMVLTAPSWFDIDLKKAREYESDCy 257 
EAY21809     195 MIVAVKIVKFKFKWFG-IQSAVESFAM-GKFHDVFLDSHRAMFSWAAQWFPMDMPAIRKLEQEVQ 257 
XP_001614288 194 IMTCYKLFNIDIPYFGmFCSKLENWIV-TVIKDSLLKYHRKALSWIDEWIDLTDEQIRAFEAEIQ 257 
Q965T2       191 FKWFGFQKIVENYAHT-QYPRLFSKFH-REVFCWIDKWHGLTMVDIREIEAKAQKELEEQRKSGQ 253  Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap