Conserved Protein Domain Family
FlgH

?
pfam02107: FlgH 
Flagellar L-ring protein
Statistics
?
PSSM-Id: 426604
Aligned: 239 rows
Threshold Bit Score: 122.626
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_021759071    44 AGNPGSLFNPGDAQ---YLF-SDNRARRIGDIVLVHITESSTSKLEANTDTSKESTKELGvenafgatsvgigkllgfdp 119 Desulfovibrio...
EFR45916        53 LPKAGSLFGSGDR----PLF-SDRRAMKPDDLITIVINENANANFTTNKNYNGASGGNVTppaieyt------------- 114
CCB80078        46 iSKPGSLFGQGER----PLF-ADRRAMKPNDLITVVISENASANYSTSKDYTSTSNGTSNaprltyn------------- 107
WP_013023498    40 fAKPGSLFGQGDK----PLF-SDRRAMRPYDLITVIINENSSANYSSSKSYNNNSSGNSTsprlqyn------------- 101 Helicobacter ...
O25092          46 lNKLGSLFGQGER----PLF-ADRRAMKPNDLITIIVSEKASANYSSSKDYKSASGGNSTpprltyn------------- 107 Helicobacter ...
Q30SL9          50 ftSVGSVFGQGEN----PLF-SDHKAMHVNDIVTVIISENTQSSNSGSKQISESDSLNLGggaftsa------------- 111 Sulfurimonas ...
jgi:Saut_1466   50 FASTGSIFGQGEN----PLF-SDHKAMHVSDIVTVVISEAAKSSNTGSKQLSENDTSALGgglfsst------------- 111
jgi:Marpi_0991  16 fsfsDSLWKKAHt---kNLYsNPEKVYSLGDIITVAVSEAPSLSLSDNNPDPFSGvmgtvgai----------------- 75 
jgi:Fnod_0844   21 fsfsTSLYTSSANPqfqNLM-GTYKASKVGDAITIVVYESPRISTSSQVNSITGAfinaint------------------ 81 
WP_013932929    16 vlnATSLWNSSNNSafkNIF-ADKKARKIGDIVTIIVRETPTFNSASEYDSLAKAlvnfitga----------------- 77  Pseudothermot...
WP_021759071   120 lklsgstGTTPLV---------KYGDS-----SDFKGEGSTERTADVSATVAARVTKILPGGLMQVEGAREVRINDETQI 185 Desulfovibrio...
EFR45916       115 gnneeqkQIVQELndqaaynltKANNT-----SNFQGGGAQTRNEALNATLTARIIKVLDNNTYFIHGRREVLVDGEKQI 189
CCB80078       108 gtdpnkrEQAQFLdnrnnysltQPATN-----NTFKGGGAQKKSENLKLTITARIVKVLENGNYFIYGSREILVDGEKQV 182
WP_013023498   102 gtdpnrlRQTQDLddrtnytmtKPSSN-----STFKGGGTQSKSESLSLVITARIVKVLENGNYFIYGKKDILVDGEKQM 176 Helicobacter ...
O25092         108 glderkkKEAEYLddknnynftKSSNN-----TNFKGGGSQKKSEDLEIVLSARIIKVLENGNYFIYGNKEVLVDGEKQI 182 Helicobacter ...
Q30SL9         112 gtnsavnSAVSKLngia-nlgfGSTSD-----SAYKGQGSATKDASFTTTVSARIVKVLQNGNYFISGKREILVDNQKQI 185 Sulfurimonas ...
jgi:Saut_1466  112 gvnsamnSKVADIngfs-nvgfNSNSS-----SAYKGSGSATKDASFTTTISARIVKILKNGNYYISGKREILIDDQKQI 185
jgi:Marpi_0991  76 fntignlDLTKFL---------PLGANspdkvSVSNKKTSSQSQAKVSLYVSAKVVEVLDNGIVKIYGEKEFKVDSQKKI 146
jgi:Fnod_0844   82 gtklvglDLSKYL-----------PTN-----SSPTDKRDNKSQANAVVELTAVVKQVDSTGKMFVEGKKQIKVGNDLRE 145
WP_013932929    78 vkgitqfDLSQFI-----------PIN-----PNTMQKHSAKLSNNVSFTISATVVDVQDN-KLVFEGSKKIKVQDQLSE 140 Pseudothermot...
WP_021759071   186 MVVRGLVRPRDISSDNSVLSTHLADARIEYYGKGVLADKQK-AGWLTRLLDNAWP 239 Desulfovibrio gigas
EFR45916       190 LELSGVVRSFDISKDNVVQSKHIANAKIAYTSAGPISDTNR-KKPISDGIESLYp 243
CCB80078       183 IKISGVVRPFDINRDNSVQSKYIADAKIAYTNIGPLSASNK-KKMASDVLQSQFP 236
WP_013023498   177 IEVSGVVRPYDINRDNTVESKYLADAKIQYANVGDLSNTSK-KKFATDAMDTeyp 230 Helicobacter mustelae
O25092         183 LKVSGVIRPYDIERNNTIQSKFLADAKIEYTNLGHLSDSNK-KKFAADAMETQMP 236 Helicobacter pylori 26695
Q30SL9         186 IQIGGVIRPYDIDQGNRINSSQMSEAKILYKTQGDVERATD-RGWGTKIIQSVWP 239 Sulfurimonas denitrificans DSM 1251
jgi:Saut_1466  186 VQLSGVIRPYDIDQYNKINSSQISDAKILYKTEGDMDRATQ-QGWGTKIVQSIWP 239
jgi:Marpi_0991 147 MIIEGYVDPQYIK-DGVIDSKNLAEAKIWYQGDTDLQKNPNkKTWLAWMlsgisn 200
jgi:Fnod_0844  146 IIITGWVHPQAIKPGNIVNSTDLINAQIWENGKVVFQDDPQqSTWLGLLlsaivg 200
WP_013932929   141 IIIRGTARYEDIDANNTIEASKLADSQIWINGRLVFSQKPGqESWLDYVltvlar 195 Pseudothermotoga thermarum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap