6HWX


Conserved Protein Domain Family
Gag_p30

?
pfam02093: Gag_p30 
Click on image for an interactive view with Cn3D
Gag P30 core shell protein
According to Swiss-Prot annotation this protein is the viral core shell protein. P30 is essential for viral assembly.
Statistics
?
PSSM-Id: 426597
Aligned: 3 rows
Threshold Bit Score: 432.938
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6HWX_A   11 QYWPFSSSDLYNWKNNNPSFSEDPGKLTALIESVLTTHQPTWDDCQQLLGTLLTGEEKQRVLLEARKAVRGNDGRPTQLP 90   Murine leukemia virus
Q27ID9  224 QYWPFSSSDLYNWKNNNPSFSEDPGKLTALIESVLITHQPTWDDCQQLLGTLLTGEEKQRVLLEARKAVRGNDGRPTQLP 303  Xenotropic MuLV-rel...
Q85521  282 QYWPFSASDLYNWKSHNPPFSQDPVALTNLIESILVTHQPTWDDCQQLLQALLTGEERQRVLLEARKQVPGEDGRPTQLP 361  Feline leukemia virus
6HWX_A   91 NEVDAAFPLERPDWDYTTQRGRNHLVLYRQLLLAGMQNAGRSPTNLAKVKGITQGPNESPSAFLERLKEAYRRYTPYDPE 170  Murine leukemia virus
Q27ID9  304 NEVNAAFPLERPDWDYTTTEGRNHLVLYRQLLLAGLQNAGRSPTNLAKVKGITQGPNESPSAFLERLKEAYRRYTPYDPE 383  Xenotropic MuLV-rel...
Q85521  362 NVIDEAFPLTRPNWDFRTPAGREHLRLYRQLLLAGLRGAARRPTNLAQVKQVVQGKEETPASFLERLKEAYRMYTPYDPE 441  Feline leukemia virus
6HWX_A  171 DPGQETNVSMSFIWQSAPDIGRKLERLEDLKSKTLGDLVREAEKIFNK 218  Murine leukemia virus
Q27ID9  384 DPGQETNVSMSFIWQSAPDIGRKLERLEDLKSKTLGDLVREAEKIFNK 431  Xenotropic MuLV-related virus VP62
Q85521  442 DPGQAASVILSFIYQSSPDIRNKLQRLEGLQGFTLSDLLKEAEKIYNK 489  Feline leukemia virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap