Conserved Protein Domain Family
tRNA_synt_2f

?
pfam02092: tRNA_synt_2f 
Glycyl-tRNA synthetase beta subunit
Statistics
?
PSSM-Id: 426596
Aligned: 420 rows
Threshold Bit Score: 518.886
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Oant_0522    4 LLLELFSEEIPARMQRKAAGDLKKMITDGLVEAGLtyeaA----TPYWTPRRLTLDIRGLTVRSKDVHEDIKGP------ 73  Ochrobactrum ...
WP_013023097     5 LFIEIFVEELPALPFLREFKNFATKWQEALQRHSI----PpiqtQFFYTPRRIVLFCEQFPIRTQEEKKEIFGPpvdvaf 80  Helicobacter ...
Q7VHA0          20 LLIEIFTEELPALPFLKELPHMVEKWQKIAQKHRI----Tst-pTLYFTPRRIVLYEQNFATHTQDILIESYGPplaiaf 94  Helicobacter ...
BAM31366         7 LLIEILTEELPALPLLKELPHIIQKWQSIAKKHNV----Sst-pTLYYTPRRLVLYEEGFLAHTPDSLIESYGPplsiay 81  Helicobacter ...
P56454           6 LLVEILVEELPAQALLNEYKEMPKKLHALFNKRAL----EvgniEIFYTPRRLCLLIKDFPLLTQETKEEFFGPpvkiac 81  Helicobacter ...
USDA:Abu_1232    5 LLIEIGVEELPAIPFLNELPNIEKKWSDILERNRL----Lcd-fDFFYTPRRLVLWHREFQVKQEDSTIEQFGApikiay 79  Arcobacter bu...
jgi:Arnit_1679   5 LLIEIGVEELPAIPFLKELPNIEKKWSDILEKFKL----Std-fDFFYTPRRLVLWHREFNLTQEDTTVEQYGApvaiay 79  Arcobacter ni...
WP_013553672     6 LLIEIGVEELPALPLLKILDRIEASWKKVLQEHQL----Ssd-fSFDYTPRRLVLRHNAIPLAQEDRVEELVGPpveiai 80  Nitratifracto...
WP_013327096     5 LLIEIGVEELPAVPLLKEMKNIERKYADILEKYSL----Lse-fEFYYTPRRLVMWHREFKTGQDDSAEEFFGAplavay 79  Sulfurimonas ...
Q30RW2           5 LLIEIGVEELPAVPLLRELKNIEKKYADILEKHSL----Lgn-fEFYYTPRRLVLWHREFKSMQDESVEEFFGAplsvay 79  Sulfurimonas ...
jgi:Oant_0522   74 SVTAPE----QAIQGFLRKAGLTdVA-QAHVhsDpkK-GDFYVAHLTKPGRAAEEIVAELVPQTIRNFPWPKSMRWGAAs 147 Ochrobactrum ...
WP_013023097    81 EKGDKNapltAAGEAFLKKNHLQ-IE-QLCYaqK--GgKEVLFSLQVQEGVSLTEILPQILKSFLQSLHFGKHMRWGNV- 155 Helicobacter ...
Q7VHA0          95 INGDKTkglsKAGESFFKKLELP-TNtPYEIriK--EnKEVLYYAKMQKGVQTKDIVGEILIEWLKALQFGKSMFWGNL- 170 Helicobacter ...
BAM31366        82 IDGDKTkglsKAGESFYKKNNLP-LEqELETriK--DnKEVLYYAITQKGVETSSLLESMVVEWLHSLQFGKSMFWGDV- 157 Helicobacter ...
P56454          82 NHQDKTqglnALGLGFYQKLGLK-DHqYFQTafK--NnKEVLYHAKIHEKEPTKDLIMPIVLEFLEGLNFGKSMRWGNV- 157 Helicobacter ...
USDA:Abu_1232   80 KDGVPT----GAAISFAAKLGID-VS-VLEKkdL--GkGEVLYFKQEVIGSESKTLLNEMINEFVASLNFGKSMRWASR- 150 Arcobacter bu...
jgi:Arnit_1679  80 KDGKPT----GAAIGFAKKCAIE-VD-DIKTinN--GkDEVLYFKKEEKGKASKDLLNEMINEFINALDFGKSMRWASR- 150 Arcobacter ni...
WP_013553672    81 KEGKPT----PAGEGFARKCGVA-FE-QLDRthK--GnREVLYYRREVPGSQTRDLLPEMIREWVASMNFGKMMRWGDR- 151 Nitratifracto...
WP_013327096    80 KDGTPT----KAAEGFARKCGVS-LE-ELSTanK--GgKEVLYYKKDVAGKPSAELLPEIIYSWLKSLDFGKSMRWGSL- 150 Sulfurimonas ...
Q30RW2          80 KDGVAT----PAALGFAKKCGVG-ID-EITTtiK--DnKEVIYYKRALMAKESSHLLPTIIKEWIDSLEFGKSMRWGSL- 150 Sulfurimonas ...
jgi:Oant_0522  148 arpgSLRWVRPLQSILCTFgpeteETVV---IDFDVDGIK--SGNVTYGHRFLsDgqpIK---VRRFEDYVEKLEKAFVV 219 Ochrobactrum ...
WP_013023097   156 ----TEDFIRPIRNIMIFL-----GEEF---VPFVGYGIE--ARPQTKLHRDF-G---LDwqeVKNFADYCKKLNEGGVI 217 Helicobacter ...
Q7VHA0         171 ----NESFIRPVRNIFILL-----GEQS---VSFNAFGLH--SIAQTYPHRDI-S---FEpyaITSPSDYFQSLEKSKVI 232 Helicobacter ...
BAM31366       158 ----EQGFIRPVRNILILL-----GEQS---ICVNAFNRHfgKQAQIFVHRDV-S---FEpfkITSIEQYFDTLQKNFVI 221 Helicobacter ...
P56454         158 ----EKSFIRPIHNICVLF-----NGEDfsgIEVKEYGFK--TKQATKVHRQE-G---FDfiqVDSPKAYFEVLEKNHVI 222 Helicobacter ...
USDA:Abu_1232  151 ----TDSFIRPIRSLSVLL-----GEEI---VDAELFGVE--SSNFSFAHRMV-S---YEpftYSFAGDYFCKLDKSGVI 212 Arcobacter bu...
jgi:Arnit_1679 151 ----TDSFIRPIRSLIMML-----GEEI---VEGELYGVK--SSNKSFAHRMV-S---YEpfsFDFAGDYFCKLDKNGVI 212 Arcobacter ni...
WP_013553672   152 ----HDEFIRPVRWLQVRL-----GQES---VPAELFGVA--SGTRTFVHRMV-S---FDpveVPDPAKFEEILQKGEVT 213 Nitratifracto...
WP_013327096   151 ----HESFIRPIRWVNVQL-----DDTL---VPMYMYGVD--SSKITRVHRIA-N---FNpveITGAKDYFETLKNGGVT 212 Sulfurimonas ...
Q30RW2         151 ----QESFIRPIRWVNVQL-----ADEL---VDMEIFGVK--SAKKTFVHRIS-N---FEaieINGAKEYFEVLEDGGVT 212 Sulfurimonas ...
jgi:Oant_0522  220 LDAERRKEIISQDAHNLAF-AsGLELVEDDGLLEEVSGLVEWPVVLMGEFEEEFLAIPPEVIRLTIRANQKCFVTRkqg- 297 Ochrobactrum ...
WP_013023097   218 LDQEERREKILSSIISLEKsQ-NIAVEVDGELLDEVVAITEYPQVILGHFEERFLELPKEVIITSMKENQRYFAVYqdk- 295 Helicobacter ...
Q7VHA0         233 LEQNKRRAMILEQIVVIESqE-NIKVEIDEALLNEIVAITEYPRAAYGIFDKQFLQLPNEVIITSMKENQRYFATYk--- 308 Helicobacter ...
BAM31366       222 LSQDKRKELILSQIAELESaH-KIQVEIDTDLLNEIVAITEYPQAAYGSFDSSFLALPSEVIITSMKENQRYFATYk--- 297 Helicobacter ...
P56454         223 LDPKKREAKILQEIKELETkH-HIIVETDRDLLDEVVAITEYPSALLGEFDKAFLKLPSEIIITSMKENQRYFATFcqks 301 Helicobacter ...
USDA:Abu_1232  213 LYPDERRKIILEQMKNIEQrH-NIKIEIDTELLEEVVAITEYPTALIGKFDEEFLELPEEVIVTSMKENQRYFAVYk--- 288 Arcobacter bu...
jgi:Arnit_1679 213 LYPEDRKKIILDQMKDIESqN-NLKIDIDPELLEEIVAITEYPTALLGSFDEEFLELPEEVIVTSMKEHQRYFAVYk--- 288 Arcobacter ni...
WP_013553672   214 LRADERRRSILEDFDTIEAeS-GLKIERDGALLDEVVAITEHPKALLGTFDEKFLELPPEVIMTSMKEHQRYFPVFdg-- 290 Nitratifracto...
WP_013327096   213 LFQQEREEKILGDIKAIEKdN-SVNVEIDDDLFAEVVAITENPTALLGSFDEAFLRLPPEVIITSMKEHQRYFPVFk--- 288 Sulfurimonas ...
Q30RW2         213 LFATQREKKIVEDFASIEKeN-GVKIEIDKELLDEVVAITENPTAILGSFDEEFLKLPPEVIITSMKEHQRYFPVFk--- 288 Sulfurimonas ...
jgi:Oant_0522  298 --eaEALSNKFILVSNIaARDGGTEIAYGNGKVVRARLSDALYFWHTdqhdlpdldklvasaekfglDLKKPLDQrmARL 375 Ochrobactrum ...
WP_013023097   296 --slQHLKNHFVMVSNS-TSKDEGIIVLGNQKVLRARLEDAMFFYHN--------------------DCKKGLSN--AGL 350 Helicobacter ...
Q7VHA0         309 ---dGHLHNGFVLVANS-TAANLGPIVQGNQKVLKARLSDAVFFYEN--------------------DLKNGFAP--EKL 362 Helicobacter ...
BAM31366       298 ---dSVLHNGFVLVSNS-TAKDLSPIVQGNQKVLKARLADAMFFYEN--------------------DLKKGFTP--ELL 351 Helicobacter ...
P56454         302 qeesPTLHNGFIVVSNA-INKDKQKIILGNQKVLKARLSDAVFFYEN--------------------DLKKPLDN--APL 358 Helicobacter ...
USDA:Abu_1232  289 ---dGNLTNNFIVVSNA-KTNDFGYIIQGNEKVLRPRLADAMFFYKN--------------------DIKNGLSN--EGL 342 Arcobacter bu...
jgi:Arnit_1679 289 ---eGKLSNNFIVVSNS-KTEDFSFIVAGNEKVLRPRLSDAMFFYKN--------------------DLNNGLSN--EGL 342 Arcobacter ni...
WP_013553672   291 ---eGRLSNHFVVVSNA-VTENYSQVIAGNERVLRPRLEDALFFYRN--------------------DLKRGLSI--EGL 344 Nitratifracto...
WP_013327096   289 ---dGQLVNKFVVVSNA-LSDDFSEVIAGNERVLRPRLADGLFFYDN--------------------DLKNGLST--KGL 342 Sulfurimonas ...
Q30RW2         289 ---dGKLINRFVVVSNA-FTNDFSKVIEGNERVLRPRLSDALFFYNN--------------------DLKKGLST--AGL 342 Sulfurimonas ...
jgi:Oant_0522  376 DalNVTFHAKLGTQGARVERIRELAAQI----------Ap--------Lvga---dpkLA-ARAAVLAKADLTTEVVGEF 433 Ochrobactrum ...
WP_013023097   351 E--KLLFIEGAGSMQDKVKREQKIAEFLiqrfdcqelsAk-----------------kAQiLECIELSKADLLSEMVYEF 411 Helicobacter ...
Q7VHA0         363 G--QILFVDGLGSLLDKTKRESVIALEL----------LkfythkidmKiqe----sqEIlSTAVKYAKADLLTEMVYEF 426 Helicobacter ...
BAM31366       352 E--QIVFVENLGSLLDKSKRESALANAL----------LesfapaldsIdmpk-dearQIlTQATKYAKADLLTEMVYEF 418 Helicobacter ...
P56454         359 E--SVVFVQGLGTLKDKMERESIIAQYL----------TqkyisslnmPlek----alELvKRAVQIAKADLLSEVVYEF 422 Helicobacter ...
USDA:Abu_1232  343 K--KLVFVEGLGSMYDKCEREAKIASYL----------Antfe-----------vkekELiQKAVMLSKADLMSEMVYEF 399 Arcobacter bu...
jgi:Arnit_1679 343 K--NLVFVDGLGSMYEKCEREVKIASYL----------Aevfe-----------ikekELlTKAVMLSKADLMSEMVYEF 399 Arcobacter ni...
WP_013553672   345 E--KIQFIDGLGTLKDKVDRERNIALRL----------AgiymdkleqEtgrsaleieELmDRAVTLAKADLLTEMVYEF 412 Nitratifracto...
WP_013327096   343 E--KVAFFKGLGSVADKIEREEKIADAL----------Ydmyqp----------dakkEDlNRAIELAKADLMSEMVYEF 400 Sulfurimonas ...
Q30RW2         343 E--KVVFMKGLGSVADKIERERKIAHAL----------FdiykplhvtL---------EElDRSITLAKADLMSEMVYEF 401 Sulfurimonas ...
jgi:Oant_0522  434 PELQGAMGRKYALLQGEDEAVAAAIEEHYKPQGPSDVVPKNPVSVAVALADKLDTLVGFWAIDEKPTGSKDPFALRRAAL 513 Ochrobactrum ...
WP_013023097   412 SNLQGVMGYYYALVIKKDPSIALGIKEQYLPLGEHSALPSTPFSAIVALAHKFDNILTLFSVGKIPTGSKDPFALRRAAN 491 Helicobacter ...
Q7VHA0         427 TELQGIIGYYYAQSFGMHPLVAQAIKEQYLPTGEDSPLPSHILSAILALSIKLDNIFALFSIDKIPSGSKDPFALRRAAN 506 Helicobacter ...
BAM31366       419 TELQGVMGYYYAKNFCFHPLVALAIKEQYLPTGEDSALPSHILSAILALSIKLDNIFALFSIDKIPSGSKDPFALRRAAN 498 Helicobacter ...
P56454         423 SELQGIMGYYYALKQNENELVALSVKEQYLPASENAPLPSSVFSSIVALSLKLDSLFSLFSVGKIPSGSKDPFALRRLSF 502 Helicobacter ...
USDA:Abu_1232  400 TELQGLMGYYYAKIAKEDNLVSLALKEQYLPTGEDSELPSNVFSSIVALSNKLDNLMALFSVGKIPTGSKDPFGLRRAAA 479 Arcobacter bu...
jgi:Arnit_1679 400 TELQGLMGYYYAKAANEDKLVFTALKEQYLPDGEDSDLPSNKFSAIVALSYKLDNLMGLFSVGKIPTGSKDPFGLRRAAA 479 Arcobacter ni...
WP_013553672   413 TELQGLMGYYYAKALGEDPLVCTAIKEQYRPEGEGAELPSTIFSSILAMAIKLDTLLGLFSVGKIPTGSKDPFALRRAVN 492 Nitratifracto...
WP_013327096   401 TELQGLMGYYYAKEAGENDAVALAIKEQYLPEGEESELPSTPLSAIVAMSIKLDTLLGLFSVNEIPTGSRDPFALRRAVN 480 Sulfurimonas ...
Q30RW2         402 TELQGLMGSYYASLLGESQNVATAIREQYLPDGEDSALPSNKMSAIVAMSLKLDTLLGLFSINQIPTGSRDPFALRRAVN 481 Sulfurimonas ...
jgi:Oant_0522  514 GVIRLLLSQEWKFPLLPLFRSAfaalkegqvqrklrefetklagensgdidgeqdvdnalasyekqvraeaeassepVLA 593 Ochrobactrum ...
WP_013023097   492 GILRIILQESFDFDLEQDLAKMlrild----------------------------------------------ldlsQTQ 525 Helicobacter ...
Q7VHA0         507 GVIKIIWHYGLDFDLSIDIPRLyqaggy----------------------------------------------kpsnmQ 540 Helicobacter ...
BAM31366       499 GVIKIINHYDLDFDLLSDMPRLyqaggy----------------------------------------------kisdmK 532 Helicobacter ...
P56454         503 GLLKIIAHYGLEFDLKADLKNLfqkvgv---------------------------------------------yqsfdlE 537 Helicobacter ...
USDA:Abu_1232  480 GIVKIAMEHKLPIDLSKIIDELstnyk------------------------------------------------nldkK 511 Arcobacter bu...
jgi:Arnit_1679 480 GIVKISMEHKLEVNLSNIIDNLldtys------------------------------------------------glkkE 511 Arcobacter ni...
WP_013553672   493 GIIRIVTRYDLSFDIPKMMELLadqya------------------------------------------------pfdeE 524 Nitratifracto...
WP_013327096   481 GIIRIVNEYGFEFDIVKTLKELsknyd------------------------------------------------aidlE 512 Sulfurimonas ...
Q30RW2         482 GLIRVTKEHDLEFDIVKTLTLLsknyd------------------------------------------------sfdiS 513 Sulfurimonas ...
jgi:Oant_0522  594 DLLSFLHDRFKVHLkeeGARYDAIDAVLS 622 Ochrobactrum anthropi ATCC 49188
WP_013023097   526 KIATFFIERMDGLL---QQNRALLKSVLA 551 Helicobacter mustelae
Q7VHA0         541 RIESFFLERLEGML---KVNPSLIRCVLN 566 Helicobacter hepaticus
BAM31366       533 RIEQFFIERLEGAL---KINPSIIRSVLK 558 Helicobacter cinaedi CCUG 18818 = ATCC BAA-847
P56454         538 ILEKFLLERFHNLI---DCNPSIIRSVLN 563 Helicobacter pylori 26695
USDA:Abu_1232  512 VLIEFFNERLFKIF---EVNPTVLKAVLA 537 Arcobacter butzleri RM4018
jgi:Arnit_1679 512 KLIEFFNERLFKIF---DVNPSVIKAVLG 537 Arcobacter nitrofigilis DSM 7299
WP_013553672   525 KLESFILERIYKSL---KANPSIIAAVLA 550 Nitratifractor salsuginis
WP_013327096   513 KLENFILERIRRYY---KVNPSIIEAVLA 538 Sulfurimonas autotrophica
Q30RW2         514 KLEAFFLERVRQYF---KVNPSIVEAVLI 539 Sulfurimonas denitrificans DSM 1251
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap