Conserved Protein Domain Family
Ornatin

?
pfam02088: Ornatin 
Ornatin
Statistics
?
PSSM-Id: 145317
View PSSM: pfam02088
Aligned: 2 rows
Threshold Bit Score: 58.0099
Threshold Setting Gi: 129225
Created: 11-May-2020
Updated: 6-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAB20874 10 LLYCGEFRELGQPDKKCRCDGKPCTVGRCNFARGDNDDKCI 50  turtle leech
P25509    1 IPQCRDVKESGQPNDKCRCNGKPCTVGKCTIARGDDNDKCT 41  turtle leech
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap