Conserved Protein Domain Family
SURF4

?
pfam02077: SURF4 
SURF4 family
Statistics
?
PSSM-Id: 111019
View PSSM: pfam02077
Aligned: 6 rows
Threshold Bit Score: 347.848
Threshold Setting Gi: 1723786
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O74559  33 SERACQFMEQAE-TFMAPFTPYMPLLGRFLIVATYFEDAIRIVTQWPEQVSYMRDYRRFRFGTAPLLLFVCVVLMLVGST 111 Schizosaccharomyces p...
O18405   5 NEYIAKTEDVAE-QVIKRGKNVLPTVARLCLIATFFEDGLRMYIQWNEQREYMDMSWGCGKFLATVFVLVNLLGQLGGCG 83  fruit fly
O15260   4 NDLMGTAEDFAD-QFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQRDYIDTTWNCGYLLASSFVFLNLLGQLTGCV 82  human
Q18864  11 NEMLAKAEDAAE-DFFRKTRTYLPHIARLCLVSTFLEDGIRMYFQWDDQKQFMQESWSCGWFIATLFVIYNFFGQFIPVL 89  Caenorhabditis elegans
O45731   4 NVVITRCEDYTE-TLARNTRKVLPTIGRLLLISTFVEDGLRLLFNTHDHVNHFSYNWGLNYHFSLFLTIVMIINLLFGSL 82  Caenorhabditis elegans
P53337  48 EKFASRIEGLTDnAVVYKLKPYIPSLSRFFIVATFYEDSFRILSQWSDQIFYLNKWKHYPYFFVVVFLVVVTVSMLIGAS 127 Saccharomyces cerevis...
O74559 112 LVVFKKRQAYAIGSLLFVTLLQAFAYGLITSGEMFFRNMSVIGGLCLVASDTFIHRRIn-RFAGLPAVSE--HNKRTYFQ 188 Schizosaccharomyces p...
O18405  84 MVMARFKVDIAVGLLFFIVVLQTVAYSILWDFQFLLRNFALIGALLLVLAEARIEGRS--LFAGVPSMGE--NKPKNFMQ 159 fruit fly
O15260  83 LVLSRNFVQYACFGLFGIIALQTIAYSILWDLKFLMRNLALGGGLLLLLAESRSEGKS--MFAGVPTMRE--SSPKQYMQ 158 human
Q18864  90 MIMLRKKVLVACGILASIVILQTIAYHILWDLKFLARNIAVGGGLLLLLAETQEEKAS--LFAGVPTMGDs-NKPKSYML 166 Caenorhabditis elegans
O45731  83 FVMMRYKVTESSAVLGFTIFAQVILYQLYTTYHLLTRNISIVAAIMLLVAENMLRKPKpaNYTQLPRDEHe-IEVTSVLL 161 Caenorhabditis elegans
P53337 128 LLVLRKQTNYATGVLCACVISQALVYGLFTGSSFVLRNFSVIGGLLIAFSDSIVQNKT--TFGMLPELNSknDKAKGYLL 205 Saccharomyces cerevis...
O74559 189 LAGRVLLIFMFLGLLAKEgsgISWTRILVHILSVTACAMVVIGFKAKFFAAVLVLILSVANFIINSFWSVPRESPYRDFY 268 Schizosaccharomyces p...
O18405 160 LAGRILLAFMFITLIRFE---LSVWQVIQDIIGSILMVLVVLGYKTKLSALILVALLTILNLYHNAWWTIPSYKPLRDFL 236 fruit fly
O15260 159 LGGRVLLVLMFMTLLHFD---ASFFSIVQNIVGTALMILVAIGFKTKLAALTLVVWLFAINVYFNAFWTIPVYKPMHDFL 235 human
Q18864 167 LAGRVLLIFMFMSLMHFE---MSFMQVLEIVVGFALITLVSIGYKTKLSAIVLVIWLFGLNLWLNAWWTIPSDRFYRDFM 243 Caenorhabditis elegans
O45731 162 AACRVCLNLMLISMVHFD---MSYTRILLCIISYGMMIFVWLGFKTRMMSFMLATWLFAYNIVLNDFWN--KDAELH-II 235 Caenorhabditis elegans
P53337 206 FAGRILIVLMFIAFTFSK----SWFTVVLTIIGT---ICFAIGYKTKFASIMLGLILTFYNITLNNYWFY--NNTKRDFL 276 Saccharomyces cerevis...
O74559 269 RYDFFQTLSIVGGLLYLVNTGPGKFSVDEKKKIY 302 Schizosaccharomyces pombe 972h-
O18405 237 KYDFFQTLSVIGGLLMIVSLGPGGVSMDEHKKKW 270 fruit fly
O15260 236 KYDFFQTMSVIGGLLLVVALGPGGVSMDEKKKEW 269 human
Q18864 244 KYDFFQTMSVIGGLLLVIAYGPGGVSVDDYKKRW 277 Caenorhabditis elegans
O45731 236 RYDFFQTLSAIGGLLLLIHTGPGEFSFDELKKKW 269 Caenorhabditis elegans
P53337 277 KYEFYQNLSIIGGLLLVTNTGAGELSVDEKKKIY 310 Saccharomyces cerevisiae S288C
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap