6VOY


Conserved Protein Domain Family
Integrase_Zn

?
pfam02022: Integrase_Zn 
Click on image for an interactive view with Cn3D
Integrase Zinc binding domain
Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. This domain is the amino-terminal domain zinc binding domain. The central domain is the catalytic domain pfam00665. The carboxyl terminal domain is a DNA binding domain pfam00552.
Statistics
?
PSSM-Id: 426567
Aligned: 17 rows
Threshold Bit Score: 41.204
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6VOY_A         99 ELHSFTHCGQTALTL-QGATTTEASNILRSCHACRK 133  Saccharolobus solfataricus P2
P04585       1157 DEHEKYHSNWRAMASdFNLPPVVAKEIVASCDKCQL 1192 HIV-1 M:B_HXB2R
XP_016280975  770 EAHKLHHLNAHTLRLaYKITREQARAIVKSCKNClt 805  gray short-tailed opossum
P31623       1453 KSHDLHHQNSHSLRLqFKISREAARQIVKSCSTCPQ 1488 Jaagsiekte sheep retrovirus
1_pfamImport    3 SSHGQLHQSALALRQmFRISLGEARDIVQQCMACSQ 38  
Q7R952         49 NFHNNFHVTAETLRSrFSLTRKEARDIVTQCQSCCE 84   Plasmodium yoelii yoelii
P11283       1443 ESHALHHQNAAALRFqFHITREQAREIVKLCPNCPD 1478 Mouse mammary tumor virus (STRAIN C3H)
2_pfamImport    3 NSHKIHHQNAAGLRYeFHFPREAARQIV--CPNCPT 36  
P03363       1170 GLHGLTHCNQRALVS-FGATPREAKSLVQTCHTCQT 1204 Human T-lymphotropic virus 2
AAM81191      590 EYHSKWHVNTHTLSFkFNIPRKQAEDIIRSCEKCVV 625  rabbit
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap