4MAC,1F2R


Conserved Protein Domain Family
CIDE-N

?
pfam02017: CIDE-N 
Click on image for an interactive view with Cn3D
CIDE-N domain
This domain is found in CAD nuclease and ICAD, the inhibitor of CAD nuclease. The two proteins interact through this domain.
Statistics
?
PSSM-Id: 426563
Aligned: 86 rows
Threshold Bit Score: 79.0825
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4MAC_B         12 RPCRVSTADRKVRKGIMAHSLEDLLNKVQDILKLK--DKPFSLVLEEDGTIVETEEYFQALAKDTMFMVLLKGQKWK 86  house mouse
EFX78302        6 KPFRLISHSRRVQFGVGVDSVAEVICKARTLFNLGv-DENIEVVLEEDGTRVTEDGFLLLLEGHTKLMILRNNTQWM 81  common water flea
EFX71643        2 KPFKLVSQDRRIKKGVVAGNMEELMQKGITRTLFNlgSENIQIVLEEDGTEVLEDEYLLFLDNNTKLMILPSNNQWN 78  common water flea
5_pfamImport    2 RPFRVCRHDRETRKGITAGTLEELKERVCQALLLPlsATSLSLACEEDGTEVDSDEFLMTLPDNTMLMALEPGQTWR 78 
12_pfamImport   2 RPFRVCTFNRESRKGVTAATLKELKQKAAHALLI---PTLLSLVCEEDGTEVDSDEFLMALPDNTVFMALEPRQTWR 75 
NP_001243186   21 RPFRVCSWNREVKKGITAGTLEELKERAGQALLI---SKMLTLVCEEDGTEVDSDEFLIALPDNTVFMCLQPEEIWK 94  zebrafish
Q4S0S9         17 RPFRVCCHSRETKKGVIAGTLEELKQKVCHALLLSlsAVSVSLVCEEDGTEVDTDDFLMTLPDNTTLMVLEPGQTWR 93  spotted green puf...
XP_003452419   44 RCFRVCTYSRMRRRSLTASSLDELLEQAARVFMMS--YQFLTLVLEEDGTVVDSEEFFQSLPNSTPLMVLEKGEMWT 118 Nile tilapia
XP_003201313   34 RPYKVCTPNRRRRKGFTATSLADLVEQVASSFLIA--CQMLTLVLEDDGTVVDSEAFFQSLPTNTPFMVLEKGDVWT 108 zebrafish
EEN47728        7 KAFRVWDGERKVKVGVVARSLHELKSKGRQHLNLPe-EEDLSIVLEEDGTVVADNEFFQFIPDQTVVQLLTEGQEWR 82  Florida lancelet
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap