4FUS,1FAE


Conserved Protein Domain Family
Glyco_hydro_48

?
pfam02011: Glyco_hydro_48 
Click on image for an interactive view with Cn3D
Glycosyl hydrolase family 48
Members of this family are endoglucanase EC:3.2.1.4 and exoglucanase EC:3.2.1.91 enzymes that cleave cellulose or related substrate.
Statistics
?
PSSM-Id: 426560
Aligned: 31 rows
Threshold Bit Score: 996.424
Created: 19-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4FUS_A                 28 YNERFMEMWNKIHDPANGYF-------SA-DGGPYHSVETLIVEAPDHGHESTSEAYSYFLLLEAYYGKVTGDWSKLRNA 99   Hahel...
A3DH67                 40 YKDLFLELYGKIKDPKNGYF-------SPdEGIPYHSIETLIVEAPDYGHVTTSEAFSYYVWLEAMYGNLTGNWSGVETA 112  Hunga...
jgi:Clocl_4007         31 FKDRFNYMYNKIHDPANGYF-------DS-EGIPYHSVETLCVEAPDYGHESTSEAASYYAWLEAVNGKLNGKWSGLTEA 102  Hunga...
CDM70442                9 YKDRFIDLWEKIHDEKNGYFkkfdvdgKS-LKVPYHSIETLICEAPDYGHETTSEAFSYYIWLEAMYGKLTGDFDSFKDS 87   Clost...
goetting:Cspa_c18580   45 YQQRFMTMWGKIHDSKNGYFknftdggTT-LKVPYHSVETFMCEAPDYGHETTSEAYSYYMWLEAMYGKFTGNWNEFKNA 123  Clost...
jgi:Clole_3668         42 YEQRFLDLYEDIKDNSNGYF-------SP-QGVPYHSIETLMVEAPDHGHESTSETASYYVWLEAMNGKFTGDFSGLKEA 113  Cellu...
Q97KK7                 49 YTQRFETMYNKMHDANNGYF-------SK-DGVPYHSVETFMVEAPDYGHETTSEAFSYYMWLEAMQGKITGNFSGVNTA 120  Clost...
jgi:Clocel_2823        41 YVQHFKDMYAKIHNANNGYF-------SD-EGIPYHAVETLMVEAPDYGHETTSEAFSYYMWLEAMNAKLTGDFSGFKKA 112  Clost...
1FAE_A                  9 YQDRFESMYSKIKDPANGYF-------SE-QGIPYHSIETLMVEAPDYGHVTTSEAMSYYMWLEAMHGRFSGDFTGFDKS 80   Rumin...
P50900                 40 YKQRFLELWEELHDPSNGYF-------SS-HGIPYHAVETLIVEAPDYGHLTTSEAMSYYLWLEALYGKFTGDFSYFMKA 111  Therm...
4FUS_A                100 WAKMEEHIIPTQEMQP--TNNFYNPSKPASYAAEHAQPSGYPSQLEF-GVPVGEDPISAKLAQTYGSWdVYGMHWLLDMD 176  Hahel...
A3DH67                113 WKVMEDWIIPDSTEQP--GMSSYNPNSPATYADEYEDPSYYPSELKFdTVRVGSDPVHNDLVSAYGPN-MYLMHWLMDVD 189  Hunga...
jgi:Clocl_4007        103 WNVVEKYFIPSESIQK--GMNRYNPSSPAGYADEFPLPDDYPAQIQS-NVTVGQDPIHQELVSAYNTYaMYGMHWLVDVD 179  Hunga...
CDM70442               88 WASTEAFIIPHGKGQN--GIEAYNPSSPATLANEYPTPDKYPTKLQF-GASVGQDPINYELKNAYGSSeMYGMHWLLDVD 164  Clost...
goetting:Cspa_c18580  124 WDSADKYIIPHGQDQA--GMNAYNPNSPATLANEYPTINKYPSKLLF-GTPVGKDPINNELKNAYGSGeMYGMHWLLDVD 200  Clost...
jgi:Clole_3668        114 WNVIEKYYIPTDLDQP--GQTDYNPNSPATYASEYPLPDYYPSQLQF-GLPVGTDPIANELKSTYGTSkIYGMHWLIDGD 190  Cellu...
Q97KK7                121 WDTAEKYMIPSHQDQP--GMDRYNASSPATYSPEWEDPSKYPSRMDQ-GAAKGQDPISDELKSAYGTSdMYGMHWLMDVD 197  Clost...
jgi:Clocel_2823       113 WDVTEKYIIPGETDQPsaSMSNYDPNKPATYAAEHPDPSMYPSQLQF-GAAVGKDPLYNELKSTYGTSqVYGMHWLLDVD 191  Clost...
1FAE_A                 81 WSVTEQYLIPTEKDQPntSMSRYDANKPATYAPEFQDPSKYPSPLDT-SQPVGRDPINSQLTSAYGTSmLYGMHWILDVD 159  Rumin...
P50900                112 WETIEKYMIPTEQDQPnrSMAGYNPAKPATYAPEWEEPSMYPSQLDF-SAPVGIDPIYNELVSTYGTNtIYGMHWLLDVD 190  Therm...
4FUS_A                177 NIYGYgnlgdGV-STPSYINTFQRGEQESVWETVTHPSWESFKWGGPNGFLPLFTKDNNY-SRQWRYTNAPDADARAVQV 254  Hahel...
A3DH67                190 NWYGF-----GTgTRATFINTFQRGEQESTWETIPHPSIEEFKYGGPNGFLDLFTKDRSY-AKQWRYTNAPDAEGRAIQA 263  Hunga...
jgi:Clocl_4007        180 NWYGY-----GTgTNCTFINTYQRGEQESVFETVPHPSIEEFKYGGRQGFSDLFTAGET--QPKWAFTIASDADGRLIQV 252  Hunga...
CDM70442              165 NWYGY-----GDdTAPVYINTFQRGPMESVWRTIPHPSIEEFKWGGQNGFLDLFTGDNSY-AKQWRYTIAPDADARAIQA 238  Clost...
goetting:Cspa_c18580  201 NWYGYgnrgdANsNAPAYINTFQRGSEESVWKTVPQPSYETFKWGGKNGYLDLFTGDNNY-SKQWRYTDAPDADARAIQA 279  Clost...
jgi:Clole_3668        191 NFYGYgrrgdGV-SAPSYINTFQRGEQESTWETIPQPSWEDFKWGGKSGFLPFFTGDANY-SKQWRYTNAPDADARLVQA 268  Cellu...
Q97KK7                198 NWYGFgnhedGT-SKNVYINTYQRGEQESVFETVPQPCWDAFKYGGKNGYLDLFTGDNSY-AKQAKYTDAPDADARAIQA 275  Clost...
jgi:Clocel_2823       192 NWYGFg---gATsTSPVYINTFQRGVQESCWETVPQPCKDEMKYGGRNGFLDLFTGDSQY-ATQFKYTNAPDADARAVQA 267  Clost...
1FAE_A                160 NWYGFgaradGT-SKPSYINTFQRGEQESTWETIPQPCWDEHKFGGQYGFLDLFTKDTGTpAKQFKYTNAPDADARAVQA 238  Rumin...
P50900                191 NWYGFgrradRI-SSPAYINTFQRGSQESVWETIPQPCWDDLTIGGRNGFLDLFVGDSQY-SAQFKYTNAPDADARAIQA 268  Therm...
4FUS_A                255 MYWAYQWIKEQGKdpEQEVPGLMAKAAKMGDYLRLAMFDKYFKKMGtqDKnAQGGKGYESAHYLMSWYYAWGGAADAnaG 334  Hahel...
A3DH67                264 VYWANKWAKEQGK--GSAVASVVSKAAKMGDFLRNDMFDKYFMKIG--AQdKTPATGYDSAHYLMAWYTAWGGGIGA--S 337  Hunga...
jgi:Clocl_4007        253 QYWANKWAKEQGQ----NLSTLNAKAAKLGDYLRYSMFDKYFMKIG--AQgKTPASGYDSCHYLLAWYYAWGGAIAG--D 324  Hunga...
CDM70442              239 TYWADAWAKEQGE----NVDEEVSKSSKMGDYLRYSMFDKYFKNIGv-GSdSPSNT---SQHYLLSWYYSWGGGLEA--N 308  Clost...
goetting:Cspa_c18580  280 TYWADEWAKTQGK----DVSQYVSKASKMGDYLRYSMFDKYFKPIGv-GA--DQQTEASGQHYLLSWYYAWGGGAGG--D 350  Clost...
jgi:Clole_3668        269 MYWAKDWAEEQGQ----NIDTYVAKASKMGDYLRYAMFDKYFMKIG--AQgKTPGQGYEAAHYLMSWYYAWGGGLDA--N 340  Cellu...
Q97KK7                276 TYEAAQAAKEDGV----DLSSIVGKASKMGDYLRYAMFDKYFRKIGn-ST--QAGNGKDSMHYLLSWYYAWGGSQNN--D 346  Clost...
jgi:Clocel_2823       268 TYYAQLAAKEWGV----DISSYVAKSTKMGDFLRYSFFDKYFRKVGn-ST--QAGTGYDSAQYLLNWYYAWGGGISS--N 338  Clost...
1FAE_A                239 TYWADQWAKEQGK----SVSTSVGKATKMGDYLRYSFFDKYFRKIGq-PS--QAGTGYDAAHYLLSWYYAWGGGIDS--T 309  Rumin...
P50900                269 TYWANQWAKEHGV----NLSQYVKKASRMGDYLRYAMFDKYFRKIGd-SK--QAGTGYDAAHYLLSWYYAWGGGITA--D 339  Therm...
4FUS_A                335 WAFRIGSSXVHFGYQNPIAAMALSEFDPLKPRTPGATEDWATGLKRSMEFYTWLQSAEGGIAGGATNSW---DGSYKPHP 411  Hahel...
A3DH67                338 WAWKIGCSHAHFGYQNPFQGWVSATQSDFAPKSSNGKRDWTTSYKRQLEFYQWLQSAEGGIAGGATNSW---NGRYEKYP 414  Hunga...
jgi:Clocl_4007        325 WSWKIGCSHVHWGYQAPLAAYALANDPDLKPKSANGAKDWNSSFKRQVELYAWLQSAEGAIAGGVTNSV---GGQYKSYN 401  Hunga...
CDM70442              309 WAWKIGCSHNHFGYQNPMTAWILTNVDNFKPKSSNGVSDWKKSLERQLEFYQWLQSSEGAIAGGATNSYmteDGSYQKYP 388  Clost...
goetting:Cspa_c18580  351 WSWKIGCSHNHFGYQNPMTAWVMSKDADFKPKSSGGASDWNKSLDRQLELYQWLQSSEGGIAGGATNSLttdAGSYQKYP 430  Clost...
jgi:Clole_3668        341 WSWRIGSSHNHFGYQSPMAAWVLSTDSDMIPKSPNAKRDWAKSLDRQIEFYQWLQSAEGAIAGGATNSY---GGSYEKYP 417  Cellu...
Q97KK7                347 WSWKIGCSHSHFGYQNPLTAWVLSTDSQFKPKSATGATDWAKSLTTQVDFYQWLQSSEGAIAGGASNSN---HGRYEAWP 423  Clost...
jgi:Clocel_2823       339 WSWRIGSSHNHFGYQNPMAAWILSNTSDFKPKSPNAATDWNNSLKRQIEFYQWLQSAEGGIAGGASNSN---GGSYQAWP 415  Clost...
1FAE_A                310 WSWIIGSSHNHFGYQNPFAAWVLSTDANFKPKSSNGASDWAKSLDRQLEFYQWLQSAEGAIAGGATNSW---NGRYEAVP 386  Rumin...
P50900                340 WAWIIGCSHVHAGYQNPMTAWILANDPEFKPESPNGANDWAKSLERQLEFYQWLQSAEGAIAGGATNSY---KGRYETLP 416  Therm...
4FUS_A                412 QdrADATFYGMVYDENPVYHDPGSGTWFGWQAWSMQRVAEYYYLKGDAQAKQLMDKWAPWVLSNINWLEDg--SFEIPAT 489  Hahel...
A3DH67                415 A--GTSTFYGMAYVPHPVYADPGSNQWFGFQAWSMQRVMEYYLETGDSSVKNLIKKWVDWVMSEIKLYDDg--TFAIPSD 490  Hunga...
jgi:Clocl_4007        402 ---GASTFYDMAYTYAPVYADPPSNNWFGMQAWSMQRMCEVYYETGDSLAKEICDKWVAWAESVCEADIEa-gTWKIPAT 477  Hunga...
CDM70442              389 S--DLPTFYGMVYDWKPVYHDPPSNNWFGMQGWSMERVAEYLYETGDKKAMDIMKKWVEWIKSVVKLYENg--DFEIPDR 464  Clost...
goetting:Cspa_c18580  431 E--GTPTFYGMAYDWQPVYHDPPSNNWFGMQTWSMQRVAELYYKTGDKRAQAVLDKWTKWVKSVVKLNDDg--TYAIPNN 506  Clost...
jgi:Clole_3668        418 A--GTSTFYGMAYDAHPVYEDPGSNQWFGMQGWSMQRMAEYYYESGDSRVKGLLDRWAAWAKSEIQLYDDg--TFAVPST 493  Cellu...
Q97KK7                424 E--GTATFDGMGYQEEPVYHDPGSNTWFGMQSWSMQRMAQYYYQSKDPKAKALLDKWVKWIKSVVKVNPNgagTFEVPSK 501  Clost...
jgi:Clocel_2823       416 A--GTATFYGMGYTPHPVYEDPGSNEWFGMQAWSMQRVAEYYYSSKDPAAKSLLDKWAKWACANVQFDDAa-kKFKIPAK 492  Clost...
1FAE_A                387 S--GTSTFYGMGYVENPVYADPGSNTWFGMQVWSMQRVAELYYKTGDARAKKLLDKWAKWINGEIKFNADg--TFQIPST 462  Rumin...
P50900                417 A--GISTFYGMAYEEHPVYLDPGSNTWFGFQAWTMQRVAEYYYLTGDTRAEQLLDKWVDWIKSVVRLNSDg--TFEIPGN 492  Therm...
4FUS_A                490 LEWTGKPEKWDPAn-PKANTNLHVSVVDHGQDLGIAAGVAKALMFYAAAa-EkydtpQNE----AK--EASKKLLDAMWT 561  Hahel...
A3DH67                491 LEWSGQPDTWTGT--YTGNPNLHVRVTSYGTDLGVAGSLANALATYAAAteRwegklDTK----AR--DMAAELVNRAWY 562  Hunga...
jgi:Clocl_4007        478 LEWSGQPDTWRGT--KPSNNNLHCKVVNYGNDIGITGSLANAFLFYDQAtqRwn--gNTTlgkkAA--DKALAMLQVVWD 551  Hunga...
CDM70442              465 LEWSGNPDNWTGS--YTGNPNLHVKVASYGKDLGITAAVAQTLLYYSAAt-KkygtfDKD----AK--DLSKELLDRMWN 535  Clost...
goetting:Cspa_c18580  507 LTWSGQPDTWNGT--YTGNPGLHVDVKDYSQDVGVTSSLANTLTYYAAAs-NkystfDKD----SA--KLAKELLDRMWK 577  Clost...
jgi:Clole_3668        494 LQWSGQPDTWTGS--YTGNKNLHVDVINYGTDLGTVASMANTLTFYAAAt-KkyspeQDY----QSyvDITKEVLDRMWT 566  Cellu...
Q97KK7                502 LSWTGQPDTWTGS--YTGNPNLHVNVDSYTTDIGTSSSTADALAYYAAAt-G-----DKD----SQ--ALSKTILDDIWK 567  Clost...
jgi:Clocel_2823       493 LVWTGQPDTWTGS--YTGNSNLHVKVEAYGEDLGVAGSLSNALSYYAKAleSstdaaDKVayntAK--ETSRKILDYLWA 568  Clost...
1FAE_A                463 IDWEGQPDTWNPTqgYTGNANLHVKVVNYGTDLGCASSLANTLTYYAAKs-G-----DET----SR--QNAQKLLDAMWN 530  Rumin...
P50900                493 LEWSGQPDTWTGT--YTGNPNLHVSVVSYGTDLGAAGSLANALLYYAKTs-G-----DDE----AR--NLAKELLDRMWN 558  Therm...
4FUS_A                562 HF--KTPKGLAAPEKRGDYARFFD-KVYVPGEFNGSMANGDAINSESTFLSMRSFYLDDPMFKQVEDALNSGEDPVFTYH 638  Hahel...
A3DH67                563 NFycSEGKGVVTEEARADYKRFFEqEVYVPAGWSGTMPNGDKIQPGIKFIDIRTKYRQDPYYDIVYQAYLRGEAPVLNYH 642  Hunga...
jgi:Clocl_4007        552 TC--RDQYGVGVKETNESLNRIFTqEVFIPAGWTGKMPNGDVIQQGVKFIDIRSKYKDDPWYEGLKKQAEQGIPFEYTLH 629  Hunga...
CDM70442              536 LY--QDDKGYSAEESKEDYSKFFEtEVYVPSGWSGKMANGDEIKSGIKFLDIRSKYKNDPDFDKISDAYKNNEAPVFKYH 613  Clost...
goetting:Cspa_c18580  578 LD--QDSKGLSVEEERADYSKIFDtKVYIPDGWSGKMPNGDVIKPGVSFLDIRSKYKQDPDFAKVEEAYKEGKAPVFKYH 655  Clost...
jgi:Clole_3668        567 LY--RDDKGVAAPEVRADYKRFFEqEVYVPSNYTGKMANGDEIVPGVTFIELRSKYKNDPDFARLEQAYKNGEDFEITYH 644  Cellu...
Q97KK7                568 NY--QDAKGVSAPE-QMDYSRVFNqEVYIPQGWTGTMPNGDVIKSGNKFIDIRSQYKNDPDYARVKSDVEAGKSSTFNYH 644  Clost...
jgi:Clocel_2823       569 SY--QDDKGIAVTETRNDFKRFNQ-SVYIPSGWTGKMPNGDVIQSGATFLSIRSKYKQDPSWPKVEAALANGTGVDMTYH 645  Clost...
1FAE_A                531 NY--SDSKGISTVEQRGDYHRFLDqEVFVPAGWTGKMPNGDVIKSGVKFIDIRSKYKQDPEWQTMVAALQAGQVPTQRLH 608  Rumin...
P50900                559 LY--RDDKGLSAPETREDYVRFFEqEVYVPQGWSGTMPNGDRIEPGVTFLDIRSKYLNDPDYPKLQQAYNEGKAPVFNYH 636  Therm...
4FUS_A                639 RFWAQTEAATAYANYAALF 657  Hahella chejuensis KCTC 2396
A3DH67                643 RFWHEVDLAVAMGVLATYF 661  Hungateiclostridium thermocellum ATCC 27405
jgi:Clocl_4007        630 RFWHQVDYAVALGIAEifg 648  Hungateiclostridium clariflavum DSM 19732
CDM70442              614 RFWTEASIAIANGVYAILs 632  Clostridium bornimense
goetting:Cspa_c18580  656 RFWAQSEAAIANGAYSILs 674  Clostridium saccharoperbutylacetonicum N1-4(HMT)
jgi:Clole_3668        645 RFWAQAEIAIANGTMAMLF 663  Cellulosilyticum lentocellum DSM 5427
Q97KK7                645 RFWAESEYAIANANYGTLF 663  Clostridium acetobutylicum
jgi:Clocel_2823       646 RFWGQSDIAIAFGTYGTLF 664  Clostridium cellulovorans 743B
1FAE_A                609 RFWAQSEFAVANGVYAILF 627  Ruminiclostridium cellulolyticum
P50900                637 RFWAQCDIAIANGLYSILF 655  Thermoclostridium stercorarium subsp. stercorarium DSM 8532
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap