1U6I


Conserved Protein Domain Family
MTD

?
pfam01993: MTD 
Click on image for an interactive view with Cn3D
methylene-5,6,7,8-tetrahydromethanopterin dehydrogenase
This enzyme family is involved in formation of methane from carbon dioxide EC:1.5.99.9. The enzyme requires coenzyme F420.
Statistics
?
PSSM-Id: 426554
Aligned: 19 rows
Threshold Bit Score: 387.454
Created: 19-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1U6I_D            4 AKAIFIKCGNLGTSMMMDMLLDERADREDVEFRVVGTSVKMDPECVEaAVEMaLdiaEDFEPDFIVYGGPNPAAPGPSKA 83  Methanopyrus...
O29544            3 VKVGVLKMGAIGTALLVEYLLDERADREDIEVRVVTSGAKMQPEEAV-VAEK-L---KEFDPDVVIVVSPNAALPGPKAA 77  Archaeoglobu...
WP_012940968      1 mRIGIAKLGAIGSAVLLEYCLDELAMRGDIETFVVSSGSKIKVEVLEeLEKR------DF--DLKIVTCPN--------A 64  Archaeoglobu...
jgi:Arcve_1338    1 mRIGIIKLGAIATALLIDYMLDERADREDIDVRTITSGSKLRERDAE-IVDK-M---REFNPDLVIVASPNAALPAAKLA 75  Archaeoglobu...
Q0W2P5            3 VRVGIVKLGNIGTSRFIDLVLDERADR-DIYVRTVGAGAKMGEAEAEe-MKK-I---IDFKPQFCIVISPNATVPGPTKA 76  uncultured m...
BAI61385          3 ARVGIVKLGNLGTSRYIDLILDERADR-DIYVRTVGTGAKLGEAEADeAVAK-I---LEFKPQLCIVISPNGALPGPTKA 77  Methanocella...
A0B7C4            2 FKIGFIKLGNIASSLVVDLALDEIAERTEIESKVVSHGPKMSRGEGErLAEE-M---RAWGPQMVVVVSPNAATPGPTAA 77  Methanothrix...
WP_014587018      2 FKIGFIKLGNVASSLVADLALDEIAERTDVEVRSLSFGAKMTVKEAE-MSAE-L---KGWGPQLVVIVGPNAATPGPTAA 76  Methanosaeta...
bsuwp:MCON_1052   2 FKIGFVKLGNIATSTAIDLSLDEIAERTDIEFKIISFGPKMTEKEGK-GAEE-L---KAWQPQLVVISSPNAATAGPTAA 76  Methanothrix...
Q8THT2            5 VNIGFIKMGNLGMSQVINLIQDEIAAREGITVRVFGTGAKMGPADAA-DTES-F---KQWNADFVVMISPNAAAPGPTAA 79  Methanosarci...
1U6I_D           84 REMLadSEYP--AVIIGDAPGLKVK-DEMEEQGLGYILVKPDAMLGARREFLDPVEMAIYNADLMKVLAATGVFRVVQEA 160 Methanopyrus...
O29544           78 REAF--EGKP--VIVISDAPAKKAK-DELKEKGFGYILINADSMIGARREFLDPTEMALFNADVVKVLAATGAFRLVQEA 152 Archaeoglobu...
WP_012940968     65 EKFLkdVNLSdrVIVITDRASK----DWLDSLNWGYIVVKADAMIGARREFLDPTEMVLYNSDLLKVLAVTGIIRLLQYE 140 Archaeoglobu...
jgi:Arcve_1338   76 RDALkaEGKP--VIVISDAPAKKVK-DELEAEGFGYILVNADSMIGARREFLDPTEMCLYNSDVIKVLAATGAFRAVQLA 152 Archaeoglobu...
Q0W2P5           77 REMLkeAGIP--TIVISDSPVLKIK-DDLKAKGFGYFVVKCDPMIGARRQFLDPTEMVLFNADVLKVLANTGVVRLIQKE 153 uncultured m...
BAI61385         78 REAIkaAGVP--TIAISDVPMMKVK-DDLKAKGLGYFIVKCDSMIGARRQFLDPTEMVLFNADMTKVLAETGVVRLIQTE 154 Methanocella...
A0B7C4           78 RSML--KGIP--LIVISDGPTKKEArDAMETEGFGYIILPMDPLIGAKREFLDPAEMAIFNADALKVLSICGAVRLVQEE 153 Methanothrix...
WP_014587018     77 RALY--RDVP--TIVISDGPSKKEArEALEAEGFGYIILPFDPLIGAKREFLDPAEMALFNSDALKVLSICGSVRLVQEE 152 Methanosaeta...
bsuwp:MCON_1052  77 REAY--RGIP--TIIISDGPSKKEArEALSAEGYGYIILPMDPLIGAKREFLDPAEMALFNSDALRVLAACGAIRLVEEE 152 Methanothrix...
Q8THT2           80 REIW--KDVP--CIVVSDGPTKKEArEALEQEGFGYIILPVDPLIGAKREFLDPVEMASFNSDAMKVLSSCGVVRLIQEE 155 Methanosarci...
1U6I_D          161 FDELIEKAKEDEi-sENDLPKLVIDRNTLLEREEFENPYAMVKAMAALEIAENVADVSVEGCFVEQDKERYVPIVASAHE 239 Methanopyrus...
O29544          153 IDKVIEDIKAGK---QPELPQIVVTAEKAVEAGKFSNPYAKAKAMAAFYIAEKVADIDVKGCFIEKDPEKYIPLVASAHE 229 Archaeoglobu...
WP_012940968    141 INRALK---------EDYLPKVVVDYNTAVKFAGFCNPYARAKAIASYIIAENISKITHKACFVEKDAENYITLCATAHE 211 Archaeoglobu...
jgi:Arcve_1338  153 VDEAIESAKAGK----PKLPRLIIDAEAAVNAGNFSNPYARAKAMAAYTIAEKVAAVTTKACFVEKDAEKYIPMVAAAHE 228 Archaeoglobu...
Q0W2P5          154 LDAVIEGFAAGQ---TPALPQIVISADKAVAAAGYKNPYAKAKAMAAFVAAEKVADIDLQGCFMQKEMEQYIPTVASAHE 230 uncultured m...
BAI61385        155 LDKCIDMINAGQ---PVTVPQIVIDAAKAVPMAGYTNPYAQAKAFAAFAAAEKVGDLDLLGCFMQKEMEQYIITVASAHE 231 Methanocella...
A0B7C4          154 IDRAIASVAAGS----PQLPHILATPELCAERMDFANPYARAKAIAALYMAQTAASIDAQACFRLKELEAIALAAAAGHE 229 Methanothrix...
WP_014587018    153 LDGAMASIISGA----PRLPTILSSPEGCTDRMAFRNPYARAKAIGALHMAQTVAGIDAAACFRLKELDRIALTAAAGHE 228 Methanosaeta...
bsuwp:MCON_1052 153 LDRTIASIISGQ----AKLPTILATPEKCAERMHFSNPYAQAKAMGALYMAQTVASIDAAACFRLKELKPIALTAAAGHE 228 Methanothrix...
Q8THT2          156 LDRVTEQVASGKsgeDLELPHIFAKPEKCVEHAGFANPYAKAKALAALHMAEKVAQVNFPACFMLKEVEQVCLTAAAGHE 235 Methanosarci...
1U6I_D          240 MMRKAAELADEARELEKSNDAVLRTPHAPDGKVLSKRKFMEDPE 283 Methanopyrus kandleri
O29544          230 MMRIAAILADQAREIEKSNDTVFRNPHAKDGKILGKTQLMAKPE 273 Archaeoglobus fulgidus DSM 4304
WP_012940968    212 MMRIAGKLADEAREIEKSNDSVLRTPHSKSGEILKKVGLydvlm 255 Archaeoglobus profundus
jgi:Arcve_1338  229 MMRYAAKLAEEAREIEKSSDAVYRTPHAKDGRVLSKWGLMEKPs 272 Archaeoglobus veneficus SNP6
Q0W2P5          231 LLREAAKLSDEARELEKATDAILRTPHAADGKVLSKTQLMLKPE 274 uncultured methanogenic archaeon
BAI61385        232 LLRTAALLCDQARELEKGGNSIKRTPHAADGKVLSKTTLVSKPE 275 Methanocella paludicola SANAE
A0B7C4          230 VIRAAARLADEARELEKSGDTVSRKPHARSGDLLVKRKLLEKPa 273 Methanothrix thermoacetophila PT
WP_014587018    229 VMRAAARLADEARELEKSTDSVSRRPHARSGAILAKTGLLDKPE 272 Methanosaeta harundinacea
bsuwp:MCON_1052 229 VMRAAARLADEARELEKSNDTVSRQPHARTGELMQKLSLLDKPE 272 Methanothrix soehngenii GP6
Q8THT2          236 IMGAAAILATQAREIEKSNDTVFRQPHAKNGTLLKKVKLYEKPE 279 Methanosarcina acetivorans C2A
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap